PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS681701 to PF01931 (NTPase_I-T)

VIMSS681701 has 180 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-56  176.4   0.0    2.3e-56  176.3   0.0    1.0  1  VIMSS681701  


Domain annotation for each sequence (and alignments):
>> VIMSS681701  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.3   0.0   2.3e-56   2.3e-56       1     162 [.       7     165 ..       7     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 176.3 bits;  conditional E-value: 2.3e-56
                  S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-EEEE CS
   NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrvsvg 96 
                  +++Np+K++A++ af++++    +++egv+v+sgv+ qP+g+ et+ GA++R+kna++  +ead++vG+E+G+e+     +++aw++v +  + ++ +
  VIMSS681701   7 ATTNPAKINAITLAFDDVYGPgqYRIEGVNVDSGVPLQPIGSTETRIGARQRVKNARQVRPEADFWVGIEAGIED----NMTFAWMVVEHL-QARGES 99 
                  69*****************976799************************************************88....9******88888.789*** PP

                  E---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHH CS
   NTPase_I-T  97 rsasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipf 162
                  rsas++lP+ +++ +++g+elg+ m  l+g +n+kq++Gaig++T+g++tR+++y+qa++lAl+pf
  VIMSS681701 100 RSASLMLPDIILQGIRQGRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALLLALVPF 165
                  *****************************************************************9 PP



Or compare VIMSS681701 to CDD or PaperBLAST