PaperBLAST – Find papers about a protein or its homologs

 

Align NP_391356.2 to PF01933 (UPF0052)

NP_391356.2 has 317 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   4.4e-114  366.7   0.1   5.1e-114  366.5   0.1    1.0  1  NP_391356.2  


Domain annotation for each sequence (and alignments):
>> NP_391356.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  366.5   0.1  5.1e-114  5.1e-114       1     292 [.       7     292 ..       7     293 .. 0.99

  Alignments for each domain:
  == domain 1  score: 366.5 bits;  conditional E-value: 5.1e-114
                  EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS CS
      UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltg 98 
                  + ++gGGtGls llrglk+   ++ta+vtvaDdggssG+lr+el+++++gDirnvl+al+d e+l+e+Lfq+Rf++++dl ghslgnl+Laa++++tg
  NP_391356.2   7 IAIFGGGTGLSVLLRGLKHKPVDITAIVTVADDGGSSGRLRNELKIPPPGDIRNVLAALSDVEPLVEDLFQHRFNKGNDLTGHSLGNLILAAMTNITG 104
                  789*********************************************************************************************** PP

                  -HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTS CS
      UPF0052  99 sleeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlv 196
                  ++ +a+ ++sk+l+vrg+vlPa++ +v l+ae+edG++++ges+i+e ++   +ikrvfl+pe+  + pe ++ i+eAdli++gpGslytSi+P+Llv
  NP_391356.2 105 DFFHAVTEMSKVLNVRGKVLPAANASVVLHAEMEDGRVVSGESTIPEYGQ---RIKRVFLTPEQIDPLPETIDVIREADLIIIGPGSLYTSILPNLLV 199
                  *********************************************99999...********************************************* PP

                  CCHHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHHHTTT--B-B--H.HHHCTT-EEEEE-- CS
      UPF0052 197 pgiaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeellekyaaegkepvelDa.kleklgvevieadl 292
                  p+i+e++ ++ akkv+++n+mtq+Get +++++dhvka+++++g g    ++d++lvn++++p+e+ +ky++e+++pv +D  +l+++g+evi++++
  NP_391356.2 200 PKIGEEVIKAPAKKVYICNVMTQPGETLHYTAADHVKALNQHMGCG----FIDTILVNSEDIPDEIKRKYEMESARPVDFDIeELKAMGLEVIRDQI 292
                  ********************************************99....*******************************98**********9876 PP



Or compare NP_391356.2 to CDD or PaperBLAST