PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS103002 to PF01933 (UPF0052)

VIMSS103002 has 331 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.1e-108  349.0   0.8   1.3e-108  348.8   0.8    1.0  1  VIMSS103002  


Domain annotation for each sequence (and alignments):
>> VIMSS103002  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.8   0.8  1.3e-108  1.3e-108       1     288 [.       6     286 ..       6     291 .. 0.98

  Alignments for each domain:
  == domain 1  score: 348.8 bits;  conditional E-value: 1.3e-108
                  EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS CS
      UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltg 98 
                  vv +gGGtGls + rgl+e+  ++ta+vtvaD+ggs+G++r+e++++a+gDirnv++al+d+e++l++LfqyRf+ +++++ghslgnll+a+++++t+
  VIMSS103002   6 VVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKIRDEMDIPAPGDIRNVIAALSDSESVLSQLFQYRFE-ENQISGHSLGNLLIAGMTNITN 102
                  89*************************************************************************.9********************* PP

                  -HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTS CS
      UPF0052  99 sleeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlv 196
                  ++ +ai+alskil+++grv+P+t+++v+l+a++edGe++ ge++i++++k   +i+rvflep++ ++++e+++a++eAdlivlgpGslytS+i +L v
  VIMSS103002 103 DFGHAIKALSKILNIKGRVIPSTNTSVQLNAVMEDGEIVFGETNIPKKHK---KIDRVFLEPNDVQPMEEAIDALREADLIVLGPGSLYTSVISNLCV 197
                  *********************************************99999...********************************************* PP

                  CCHHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHHHTTT--B-B--H.HHHCTT-EEE CS
      UPF0052 197 pgiaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeellekyaaegkepvelDa.kleklgvevi 288
                  +gi++al +s+a+k++vsn+mtq+Getdg+sv+dh++ai+r++g+     ++d+v++ t+++++++l+ky++++++pve+++ +lek+ ++v 
  VIMSS103002 198 NGISDALIHSDAPKLYVSNVMTQPGETDGYSVKDHIDAIHRQAGQP----FIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKaELEKESINVK 286
                  ********************************************99....*******************************889999998875 PP



Or compare VIMSS103002 to CDD or PaperBLAST