PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS12399 to PF01933 (UPF0052)

VIMSS12399 has 462 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   3.3e-113  363.8   0.0   4.2e-113  363.5   0.0    1.1  1  VIMSS12399  


Domain annotation for each sequence (and alignments):
>> VIMSS12399  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  363.5   0.0  4.2e-113  4.2e-113       1     292 [.     149     434 ..     149     435 .. 0.99

  Alignments for each domain:
  == domain 1  score: 363.5 bits;  conditional E-value: 4.2e-113
                 EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS- CS
     UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltgs 99 
                 +vv+gGGtGls+llrglk+++a++ta+vtvaDdggssG+lrre+g+l++gDirn++ al+d+e+ll+eLfqyRfk+++ l+ghs+gnl+L+a+ae+tg+
  VIMSS12399 149 IVVVGGGTGLSTLLRGLKHYSANITAIVTVADDGGSSGRLRREMGMLPPGDIRNCIGALADEEKLLTELFQYRFKAGDGLSGHSFGNLFLTAMAEITGD 247
                 8************************************************************************************************** PP

                 HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTSCC CS
     UPF0052 100 leeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlvpg 198
                 le a  a+sk+l+vrg+vlPat d+v+l+ae+edG+ ++ges+i+ea+    +i+r+ + pe ++a p vl+aik+Ad i++gpGslytSi+P+Ll+p+
  VIMSS12399 248 LEMAAIACSKVLAVRGKVLPATLDDVKLWAEMEDGRYVEGESNIPEAQG---RIRRIGCLPESPKALPAVLKAIKAADYIIIGPGSLYTSILPNLLIPE 343
                 ********************************************88888...*********************************************** PP

                 HHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHHHTTT--B-B--H.HHHCTT-EEEEE-- CS
     UPF0052 199 iaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeellekyaaegkepvelDa.kleklgvevieadl 292
                 i+ a++++k ++++++n+mtq+Getd+++vsdh+ ai +  +++    + davlv+++++++ +l+kyaae+++pv+lD+ ++ ++g++++ a++
  VIMSS12399 344 IQTAIAKAKVPRIYICNVMTQPGETDNYTVSDHLTAIDQVSSAR----LYDAVLVQRNPPSAPVLKKYAAENSHPVYLDRqAVIEKGCRIVLANV 434
                 ******************************************99....*******************************98999*****998876 PP



Or compare VIMSS12399 to CDD or PaperBLAST