PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS158695 to PF01933 (UPF0052)

VIMSS158695 has 322 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   2.1e-102  328.4   1.2   2.4e-102  328.2   1.2    1.0  1  VIMSS158695  


Domain annotation for each sequence (and alignments):
>> VIMSS158695  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  328.2   1.2  2.4e-102  2.4e-102       1     292 [.       9     291 ..       9     292 .. 0.98

  Alignments for each domain:
  == domain 1  score: 328.2 bits;  conditional E-value: 2.4e-102
                  EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS CS
      UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltg 98 
                  vvv+gGGtGl+ +l+glk+   +lta+vtvaDdggssG++r+++++l++gDirnv++al++ ++ + +LfqyRf+ dgdl+gh++gnl+L+al++l+ 
  VIMSS158695   9 VVVIGGGTGLPVILKGLKKKDIHLTAIVTVADDGGSSGKIREQMDVLPPGDIRNVMLALSNVDPRVVDLFQYRFAVDGDLSGHVIGNLILTALSQLND 106
                  8************************************************************************************************* PP

                  -HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTS CS
      UPF0052  99 sleeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlv 196
                  s  +ai+ l+++lk+rg+v+Patd+p+ l+ae+edG++++ges i+ ++k   +i+rv++epe+ ++ p ++ea+keAdliv+gpGslytSi+P+Ll+
  VIMSS158695 107 SYVDAINVLATVLKIRGKVIPATDQPLILNAEMEDGSIVHGESLIPLQGK---HINRVYIEPENVKPYPTAVEAVKEADLIVIGPGSLYTSILPNLLL 201
                  *********************************************99999...********************************************* PP

                  CCHHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHHHTTT--B-B--H.HHHCTT-EEEEE-- CS
      UPF0052 197 pgiaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeellekyaaegkepvelDa.kleklgvevieadl 292
                   ++a+++ +ska+kv++ ni tq Getd fs +dh+k i+++vgk     ++d  l+nt++vp+ell     e+  +ve++a  +e+lgve+i +d+
  VIMSS158695 202 TELADEITASKAPKVYITNILTQIGETDFFSDADHIKVIHEHVGKS----FIDKTLINTTTVPKELL---FPEDVAQVEHNAkGMEELGVEAIYQDF 291
                  ********************************************88....***************99...569999*****9899********9987 PP



Or compare VIMSS158695 to CDD or PaperBLAST