PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS164651 to PF01933 (UPF0052)

VIMSS164651 has 456 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.5e-115  369.4   0.0   7.9e-115  369.1   0.0    1.1  1  VIMSS164651  


Domain annotation for each sequence (and alignments):
>> VIMSS164651  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  369.1   0.0  7.9e-115  7.9e-115       1     292 [.     139     425 ..     139     426 .. 0.98

  Alignments for each domain:
  == domain 1  score: 369.1 bits;  conditional E-value: 7.9e-115
                  EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS CS
      UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltg 98 
                  +vv+gGGtGls+llrglk+++a++ta+vtvaDdggssG+lr+e+g+l++gDirn+l+al+d+e+ll+eLfqyRf++++ l ghs+gnl+L+a++++tg
  VIMSS164651 139 IVVIGGGTGLSTLLRGLKTYSANITAIVTVADDGGSSGRLRQEFGVLPPGDIRNCLAALADEEKLLTELFQYRFRAGDGLTGHSFGNLFLTAMSDITG 236
                  8************************************************************************************************* PP

                  -HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTS CS
      UPF0052  99 sleeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlv 196
                  +le+a++a sk+l+vrg+vlPat ++v+l+ael+dG+ i+ges+i++a+    +i ++ + p+++ a p +++aikeAd i++gpGslytS+iP+Llv
  VIMSS164651 237 DLERAVAASSKVLAVRGQVLPATLSDVRLWAELADGRRIEGESSIPKAGG---KIVKIGCIPANPPALPAAIKAIKEADYIIIGPGSLYTSLIPNLLV 331
                  *********************************************99999...********************************************* PP

                  CCHHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHHHTTT--B-B--H.HHHCTT-EEEEE-- CS
      UPF0052 197 pgiaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeellekyaaegkepvelDa.kleklgvevieadl 292
                  ++ia+a+++s+a++++v+n+mtq+Get+g++v+dh++ai +a+g++   +++davlv++++++++ l +ya+++++pv lD+ ++++lg +++ a++
  VIMSS164651 332 SDIADAIAQSQAPRIYVCNVMTQPGETQGYTVADHIRAIDAACGER---QLFDAVLVHKKSPSAQSLIRYAQQDSHPVFLDReAVSQLGRRIVLANV 425
                  ********************************************77...8**********9********************9899****99998876 PP



Or compare VIMSS164651 to CDD or PaperBLAST