PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1747661 to PF01933 (UPF0052)

VIMSS1747661 has 354 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.3e-73  233.9   0.0    1.6e-73  233.6   0.0    1.0  1  VIMSS1747661  


Domain annotation for each sequence (and alignments):
>> VIMSS1747661  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  233.6   0.0   1.6e-73   1.6e-73       1     266 [.       5     273 ..       5     295 .. 0.92

  Alignments for each domain:
  == domain 1  score: 233.6 bits;  conditional E-value: 1.6e-73
                   EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-C...HHHHHCH-B-SSSSSSTT-BHHHHHHHHHH CS
       UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidder...lleeLfqyRfkgdgdlaghslgnllLaala 94 
                   +v+lgGG+Gl   l++ +++t+++tavvtvaDdggssG+lr+el+++++gD+r  l+al+ d +   l++ ++q+Rf g+g lagh +gnl+La+l+
  VIMSS1747661   5 IVALGGGHGLYATLSAARRLTPHVTAVVTVADDGGSSGRLRSELDIVPPGDLRMALAALASDSPhgrLWATIIQHRFGGSGALAGHPIGNLILAGLN 101
                   8**********************************************************55555588****************************** PP

                   HHHS-HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-E.......EESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS CS
       UPF0052  95 eltgsleeaiealskilkvrgrvlPatddpvelsaeledGee.......itgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpG 184
                   e+  +  +a+++l +il+v+grvlP++   +++ a ++  e        i+g+ +i+++     +++rv l p ++ a+++++eai++Adl+vlgpG
  VIMSS1747661 102 EVLADPVAALDELGRILGVKGRVLPMCPIALQIEADVSGLESdprmsrvIRGQVAIATTVG---KVRRVRLLPGDPPATRQAVEAIMSADLVVLGPG 195
                   *************************************44444788888899*****88877...9******************************** PP

                   -IIIIIHHHHTSCCHHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHH CS
       UPF0052 185 slytSiiPiLlvpgiaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeelleky 266
                   s++tS+iP++lvp++a+alre++a++ lv+n+  ++Get gfs+++h++ + ++++       v +++v+ s+vp++  +++
  VIMSS1747661 196 SWFTSVIPHVLVPELAAALRETSARRALVLNLAAEPGETAGFSAERHLHVLSQHAPDF----RVHDIIVDASRVPSDREREQ 273
                   ********************************************************44....79999999998887655444 PP



Or compare VIMSS1747661 to CDD or PaperBLAST