PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS66149 to PF01933 (UPF0052)

VIMSS66149 has 322 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   2.8e-116  373.9   0.1   3.3e-116  373.7   0.1    1.0  1  VIMSS66149  


Domain annotation for each sequence (and alignments):
>> VIMSS66149  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  373.7   0.1  3.3e-116  3.3e-116       1     290 [.       6     289 ..       6     292 .. 0.99

  Alignments for each domain:
  == domain 1  score: 373.7 bits;  conditional E-value: 3.3e-116
                 EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS- CS
     UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltgs 99 
                 vvv+gGGtGls llrglk++  ++ta+vtvaDdggssG+lr+el+++++gD+rnvlval++ e+lle+Lfq+Rf++++ l+ghslgnllLa+++++tg+
  VIMSS66149   6 VVVFGGGTGLSVLLRGLKTFPVSITAIVTVADDGGSSGRLRKELDIPPPGDVRNVLVALSEVEPLLEQLFQHRFENGNGLSGHSLGNLLLAGMTSITGD 104
                 8************************************************************************************************** PP

                 HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTSCC CS
     UPF0052 100 leeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlvpg 198
                 ++++i ++sk+l+vrg+vlPa++ ++ l+ e+edG+++tges+i++a+k   +ikrvfl+p++ ++ +e leai++Ad+iv+gpGslytS++P+Llvpg
  VIMSS66149 105 FARGISEMSKVLNVRGKVLPASNRSIILHGEMEDGTIVTGESSIPKAGK---KIKRVFLTPKDTKPLREGLEAIRKADVIVIGPGSLYTSVLPNLLVPG 200
                 ********************************************99999...*********************************************** PP

                 HHHHHHH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---HHHHHHHHTTT--B-B--H.HHHCTT-EEEEE CS
     UPF0052 199 iaealreskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevpeellekyaaegkepvelDa.kleklgveviea 290
                 i ea+++s+a+kv+++n+mtq+Getdg+++sdh++ai++++g g    +vd++lv+ +++++++ +kya+e++epv +D+ kl++lgv +i++
  VIMSS66149 201 ICEAIKQSTARKVYICNVMTQNGETDGYTASDHLQAIMDHCGVG----IVDDILVHGEPISDTVKAKYAKEKAEPVIVDEhKLKALGVGTISD 289
                 ******************************************99....*******************************98********9986 PP



Or compare VIMSS66149 to CDD or PaperBLAST