PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS674156 to PF01933 (UPF0052)

VIMSS674156 has 296 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-80  255.8   0.0    3.3e-80  255.5   0.0    1.0  1  VIMSS674156  


Domain annotation for each sequence (and alignments):
>> VIMSS674156  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  255.5   0.0   3.3e-80   3.3e-80       1     278 [.       9     283 ..       9     294 .. 0.91

  Alignments for each domain:
  == domain 1  score: 255.5 bits;  conditional E-value: 3.3e-80
                  EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHHHHHHHHHHHS CS
      UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnllLaalaeltg 98 
                  vv++gGG+Gl ++l++lk++ ++ t +v ++D+ggs+G++r+  g++a+gD rn++ +li+++++ + +f+yRfkg+g+l+gh+lgnl+L+al++l+ 
  VIMSS674156   9 VVAVGGGHGLGRMLAALKDFGSNATGIVATTDNGGSTGRIRHCQGGIAWGDTRNCINQLITEPSISSMMFEYRFKGSGELDGHNLGNLMLTALDNLSV 106
                  8***********************************************************************************************99 PP

                  -HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH-SEEEE-SS-IIIIIHHHHTS CS
      UPF0052  99 sleeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeAdlivlgpGslytSiiPiLlv 196
                  +  +ai++++++lkv++++lP++++p +l a  +dG+ +tge+++   ++++++ +r+ l+pe + a++e+++a++eAd+i+lgpGs++tSi+P Ll+
  VIMSS674156 107 RPLDAINLVRDMLKVQVNILPMSEHPSDLTALSTDGRWVTGETNV---DEMETDLRRLDLSPEVP-ATKEAVTALEEADAIILGPGSFLTSIMPPLLL 200
                  *********************************************...55667***********9.******************************** PP

                  CCHHHHH.HH-SSEEEEE--SB--TTTSTT-BHHHHHHHHHHCH-SS....S-SEEEEE-S---..HH..HHHHHHTTT--B-B--H CS
      UPF0052 197 pgiaeal.reskakkvlvsnimtqkGetdgfsvsdhvkaieravgkgvakayvdavlvntsevp..ee..llekyaaegkepvelDa 278
                  p++++a+ +++kak ++v+n+  + G + ++s+++ ++++era++ +     +d+vl +t++++  ++   + +  a+ ++ +++D+
  VIMSS674156 201 PELGKAIaKNTKAKLIFVANLSPEFGPAGRMSFEQKLEWCERACQGR----KIDVVLGDTEHPElkDQwhFVTQSLASANRDWRHDR 283
                  *********************************************77....8*****988833200211122223335556666665 PP



Or compare VIMSS674156 to CDD or PaperBLAST