PaperBLAST – Find papers about a protein or its homologs

 

Align ecocyc::G6402-MONOMER to PF01933 (UPF0052)

ecocyc::G6402-MONOMER has 302 amino acids

Query:       UPF0052  [M=293]
Accession:   PF01933.18
Description: Uncharacterised protein family UPF0052
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    1.7e-83  266.3   0.1      2e-83  266.0   0.1    1.0  1  ecocyc::G6402-MONOMER  


Domain annotation for each sequence (and alignments):
>> ecocyc::G6402-MONOMER  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  266.0   0.1     2e-83     2e-83       1     280 [.      12     289 ..      12     300 .. 0.92

  Alignments for each domain:
  == domain 1  score: 266.0 bits;  conditional E-value: 2e-83
                            EEEEE-CHHHHHHHHHHCCSSCEEEEEE-----SHHHHHHHHHHTS---HHHHHHHHHH--S-CHHHHHCH-B-SSSSSSTT-BHHHH CS
                UPF0052   1 vvvlgGGtGlskllrglkevtaeltavvtvaDdggssGelrrelgllaigDirnvlvalidderlleeLfqyRfkgdgdlaghslgnl 88 
                            vv+lgGG+Gl ++l++l+++ ++lt +vt++D+ggs+G++rr+ g++a+gD+rn+l +li+++++ +++f+yRf g+g+l+gh+lgnl
  ecocyc::G6402-MONOMER  12 VVALGGGHGLGRVLSSLSSLGSRLTGIVTTTDNGGSTGRIRRSEGGIAWGDMRNCLNQLITEPSVASAMFEYRFGGNGELSGHNLGNL 99 
                            8*************************************************************************************** PP

                            HHHHHHHHHS-HHHHHHHHHHHTT-SSEEEES-SS--EEEEEETTS-EEESTTTGGGG-S...-EEEEEEESTT----HHHHHHHHH- CS
                UPF0052  89 lLaalaeltgsleeaiealskilkvrgrvlPatddpvelsaeledGeeitgeskisearklkapikrvflepegaeaapevleaikeA 176
                            +L+al++l+ +  eai++++++lkv+ +++P++++pv+l+a  ++G+e+ ge +i   ++l++pi+++ l+p+ + a++e++ ai+eA
  ecocyc::G6402-MONOMER 100 MLKALDHLSVRPLEAINLIRNLLKVDTHLIPMSEHPVDLMAIDDQGHEVYGEVNI---DQLTTPIQELLLTPNVP-ATREAVHAINEA 183
                            ********99*********************************************...77889*********999.************ PP

                            SEEEE-SS-IIIIIHHHHTSCCHHHHHHH-SSEEEEE--SB--TTT.STT-BHHHHHHHHHHCH-SS....S-SEEEE....E-S--- CS
                UPF0052 177 dlivlgpGslytSiiPiLlvpgiaealreskakkvlvsnimtqkGe.tdgfsvsdhvkaieravgkgvakayvdavlv....ntsevp 259
                            dli++gpGs+ytS++PiLl+++ia+alr++ a++v++ n+  + +  + +++++  ++ +e++vgk+    ++dav+v    + s+v+
  ecocyc::G6402-MONOMER 184 DLIIIGPGSFYTSLMPILLLKEIAQALRRTPAPMVYIGNLGRELSLpAANLKLESKLAIMEQYVGKK----VIDAVIVgpkvDVSAVK 267
                            *****************************************97765356****************99....99999985555555666 PP

                            HHHHHHHHT.TT--B-B--HHH CS
                UPF0052 260 eellekyaa.egkepvelDakl 280
                            e+++ ++ + +++ p+++D++l
  ecocyc::G6402-MONOMER 268 ERIVIQEVLeASDIPYRHDRQL 289
                            6665555444778899999743 PP



Or compare ecocyc::G6402-MONOMER to CDD or PaperBLAST