B8BDU9 has 903 amino acids
Query: ARMT1-like_dom [M=311] Accession: PF01937.23 Description: Damage-control phosphatase ARMT1-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-48 151.9 0.0 1.7e-48 151.4 0.0 1.1 1 B8BDU9 Domain annotation for each sequence (and alignments): >> B8BDU9 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 151.4 0.0 1.7e-48 1.7e-48 21 303 .. 578 887 .. 558 893 .. 0.85 Alignments for each domain: == domain 1 score: 151.4 bits; conditional E-value: 1.7e-48 ARMT1-like_dom 21 tddeeelkkileelaelkeelqkdkplppl..lfaecylyrrllellgnyDpFkelKeesnekalklveelaekleeledekelfkellkialaG 113 +d +++++++++ ++ +++l ++++ l ++l++++l+ +++ D + +K+++ne++l+++++l +l++ ++e ++ +l++++la B8BDU9 578 DDAKRRGDAFAHAFSAHLARLMEEPAAYGKfgLANLLELREECLREFQFVDAYVSIKQRENEASLAVLPDLLMELDSMNEE-ARLLALIEGVLAA 671 4444444444444444333333333332223455899*******************************************9.************* PP ARMT1-like_dom 114 NviDlglla....eediekdq.eeelrealeknllvddlekllekl....kkkkakrvlivlDNaGfElvfDll.lieeLlesglatkvvlhvkg 198 N++D+g+ a +++ + +r+++++++ +dd++ +++++ k+++ kr+l+++DN+G+++v++++ l++eLl+ +t+vvl++++ B8BDU9 672 NIFDWGSRAcvdlYHKGTIIEiYRMSRKKMQRPWRIDDFDMFKKRMladkKGQPYKRALLFVDNSGADVVLGMIpLARELLR--NGTEVVLVANS 764 *********97763333333358899********************************************************..*********** PP ARMT1-like_dom 199 iPivnDvtleDaewlleqlkdse..................algaglde....klgklilsgsdfwtpgldleemspelyeelekadLvifKGdl 271 P +nDvt +++ ++++ +++ ++++l+ ++ +g +p++d++++s+el+++ ++adL i++G+ B8BDU9 765 LPALNDVTANELPGIVAEAAKHCgilrkaaeagglifdamaGIQDDLKDepvsVPLMVVENGCG--SPCIDFRQVSSELAAAAKDADLLILEGM- 856 *************9*99999999**************888867777766775344566777777..****************************. PP ARMT1-like_dom 272 NyrkLtgdrdwppttpvlaLrtaKcdvvagll 303 r+L+++ ++++++++l+L ++K++ +a+ l B8BDU9 857 -GRSLHTNLNARFKCDTLKLAMVKNQRLAEKL 887 .*************************999876 PP
Or compare B8BDU9 to CDD or PaperBLAST