PaperBLAST – Find papers about a protein or its homologs

 

Align NP_611633.2 to PF01937 (DUF89)

NP_611633.2 has 464 amino acids

Query:       DUF89  [M=353]
Accession:   PF01937.19
Description: Protein of unknown function DUF89
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.7e-109  352.1   0.1   2.1e-109  351.8   0.1    1.1  1  NP_611633.2  


Domain annotation for each sequence (and alignments):
>> NP_611633.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  351.8   0.1  2.1e-109  2.1e-109       1     353 []      58     434 ..      58     434 .. 0.99

  Alignments for each domain:
  == domain 1  score: 351.8 bits;  conditional E-value: 2.1e-109
                  HHHTHHHHHHHHHHHHHHHHTCC........HHHHHHHHHHHHHHHHHHHHCTTCGHHH-HHHH...............T-BTTBSBHHHHHHHHHHH CS
        DUF89   1 tleerlpciltqviddlekakde........keeelkkiieelselkeelqtdkpltpledeee...............krswfnapwlfaecylyrr 75 
                  t+++r p++l+ +i  l+ ++++        ++ +lk++i++l+ l++++ ++++++ +  +++               +r+wf+a wl+a cy+yrr
  NP_611633.2  58 TFKRRSPAFLRDLITFLQDREADiieqcgdyAHFDLKRTIWSLELLRDDIINNREFQIIRVKSPdtdswnsflkglgedRRQWFSAIWLHADCYMYRR 155
                  789****************999999999999****************************88888********************************** PP

                  HHHHHTHSGGGTTS-TTHHHHHHHHHHHHHHHHHHHHHHHHCCSHHHHHHHHHHHHHHHCG--CCCHTSHHCHHHHHHHHHHHHHHCTESEE-HHHHH CS
        DUF89  76 llelfglskelknyDpFkeqKeesnksalkaveelakrleeledekelfkellkislwGNaiDlsllateediqkdqeeearkaleknilvddleklw 173
                  ++++f++s++lknyD+F +qK++  ++ + +++++  +++++++++e+f+ llk+s w+N  Dl++++      +d+  +  ++++ ++l d++ ++w
  NP_611633.2 156 IWSIFQRSETLKNYDYFGDQKTSIVTNVAPLMRDILVSTKGIKRSQEDFQYLLKLSTWSNHGDLNITR---RGAHDKIYKQIAKYDIDLLADQSFDVW 250
                  ********************************************************************...999************************ PP

                  HHH.CTCHTSEEEEE--BTTHHHHHHHHHHHHHHHCTTTSEEEEEEBSS--TTTB-BHHHHHHHHHHHH-TTTSHHHHCHTTHHHHHHTSEEEEESSC CS
        DUF89 174 ekl.kkkkakrvdivlDNaGfElvfDlllaeeLlesglatkVvlhvkaiPwfvsDvtpeDfewlleqladsksfelsalgagldellkegklvlrgss 270
                  ++l +++ +  vdiv+DNaGfEl++Dlll e+++esgla++V++hvkaiPwf+sD+t++Df+wl++ l++++++el+a+g++++ ++++ +++l ++s
  NP_611633.2 251 QDLiEASAPVYVDIVCDNAGFELFADLLLGEYIIESGLASRVRFHVKAIPWFISDCTHKDFNWLVKFLRKHEFQELNAFGKRIRGYIRDRSFILCDKS 348
                  ***9********************************************************************************************** PP

                  .GGSSS--CCGSS.SHHHHHHHHHC-SEEEEEHHHHHHHHTTSCTTTTTSEHHHHT.GTSS--EEEEEE--SHHHHHHHSTTTHEE CS
        DUF89 271 .fwttglsysemp.eapelyeelekadLvifKGdlNyrkLtgdrkwppttpfttal.gfspvpvlaLrtvKadvvagllegegekl 353
                   fwt+g++ys+m+ ++p ly  +++a+LvifKGdlNyrkL+gd +++ptt+f+++l gf+p +v+aLr++K+d+++gl+ ++ ekl
  NP_611633.2 349 yFWTSGHDYSQMKrVQPCLYVYISQASLVIFKGDLNYRKLLGDINNKPTTQFSDCLrGFQPSSVCALRVIKSDIYCGLPICTVEKL 434
                  *******************************************************************************9988876 PP



Or compare NP_611633.2 to CDD or PaperBLAST