PaperBLAST – Find papers about a protein or its homologs

 

Align NP_611635.1 to PF01937 (DUF89)

NP_611635.1 has 478 amino acids

Query:       DUF89  [M=353]
Accession:   PF01937.19
Description: Protein of unknown function DUF89
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.6e-119  385.1   2.1   1.8e-119  384.8   2.1    1.0  1  NP_611635.1  


Domain annotation for each sequence (and alignments):
>> NP_611635.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  384.8   2.1  1.8e-119  1.8e-119       1     353 []      65     451 ..      65     451 .. 0.99

  Alignments for each domain:
  == domain 1  score: 384.8 bits;  conditional E-value: 1.8e-119
                  HHHTHHHHHHHHHHHHHHHHTCC.............HHHHHHHHHHHHHHHHHHHHCTTCGHHH-HHHH...............T-BTTBSBHHHHHH CS
        DUF89   1 tleerlpciltqviddlekakde.............keeelkkiieelselkeelqtdkpltpledeee...............krswfnapwlfaec 70 
                  tl+ rlp+ilt+vid+l+++k+e             ++eelk ii+ +s+lk+elqtdk+++++++ee+               +rs+++a+ l+aec
  NP_611635.1  65 TLRSRLPVILTNVIDTLTRDKSElvaqfasnefsqaAREELKIIIGLISRLKYELQTDKSFQNFTGEEPdrdvwnnfisnlpdgERSFYKASSLHAEC 162
                  7899***************999999***************************************99999***************************** PP

                  HHHHHHHHHHTHSGGGTTS-TTHHHHHHHHHHHHHHHHHHHHHHHHCCSHHHHHHHHHHHHHHHCG--CCCHTSHHCHHHHHHHHHHHHHHCTESEE- CS
        DUF89  71 ylyrrllelfglskelknyDpFkeqKeesnksalkaveelakrleeledekelfkellkislwGNaiDlsllateediqkdqeeearkaleknilvdd 168
                  yl+r+l++++++s  lk+yD+F+++Ke++++++++ + +l+k+++++e++ e f+ell+i++w+N+ D++  + + + ++ q+ e+ +++++++lv++
  NP_611635.1 163 YLHRKLHSFLENSVFLKSYDFFAKVKEQALTDSIDDILALTKYTRRSENSVEVFDELLRINMWSNCNDVATDTDTVKQSNRQVLEKVANTDERVLVNQ 260
                  *************************************************************************999999******************* PP

                  HHHHHHHH...CTCHTSEEEEE--BTTHHHHHHHHHHHHHHHCTTTSEEEEEEBSS--TTTB-BHHHHHHHHHHHH-TTTSHHHHCHTTHHHHHHTSE CS
        DUF89 169 leklwekl...kkkkakrvdivlDNaGfElvfDlllaeeLlesglatkVvlhvkaiPwfvsDvtpeDfewlleqladsksfelsalgagldellkegk 263
                   +++w++l   k kk+k+vd++lDNaG+El+ D++lae+++e+gla+kV++hvka+Pwfv+Dvt +Df+w+le+l+++ ++ +s +g+++ ++++egk
  NP_611635.1 261 AAEIWRCLenpKLKKHKQVDFILDNAGYELFSDFILAEFMIEKGLADKVRFHVKAHPWFVTDVTERDFKWTLEYLSEHADYIISLIGKKFLQFIDEGK 358
                  ************************************************************************************************** PP

                  EEEESSC.GGSSS--CCGSS.SHHHHHHHHHC-SEEEEEHHHHHHHHTTSCTTTTTSEHHHHT.GTSS--EEEEEE--SHHHHHHHSTTTHEE CS
        DUF89 264 lvlrgss.fwttglsysemp.eapelyeelekadLvifKGdlNyrkLtgdrkwppttpfttal.gfspvpvlaLrtvKadvvagllegegekl 353
                  + l + s fwt+++s+++m+ ++p+ly++l+ ++Lv+fKG lNyrkL++d +w+pt++++t+l gf p ++++Lr+vK++v++gl+eg+g++l
  NP_611635.1 359 FELAPIShFWTSPHSFYSMAqMDPDLYSSLQLSKLVVFKGELNYRKLLQDVCWDPTQELSTCLrGFLPSNICVLRRVKSEVISGLPEGVGQAL 451
                  *****999********************************************************************************99875 PP



Or compare NP_611635.1 to CDD or PaperBLAST