PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9NVE7 to PF01937 (DUF89)

SwissProt::Q9NVE7 has 773 amino acids

Query:       DUF89  [M=353]
Accession:   PF01937.19
Description: Protein of unknown function DUF89
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    5.8e-61  192.4   0.0    8.5e-61  191.9   0.0    1.1  1  SwissProt::Q9NVE7  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9NVE7  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  191.9   0.0   8.5e-61   8.5e-61       1     347 [.     451     758 ..     451     762 .. 0.93

  Alignments for each domain:
  == domain 1  score: 191.9 bits;  conditional E-value: 8.5e-61
                        HHHTHHHHHHHHHHHHHHHHTCC...HHHHHHHHHHHHHHHHHHHHCTTCGHHH-HHHHT-BTTBSBHHHHHHHHHHHHHHHHTHSGGGTTS CS
              DUF89   1 tleerlpciltqviddlekakde...keeelkkiieelselkeelqtdkpltpledeeekrswfnapwlfaecylyrrllelfglskelkny 89 
                        ++ee l+ ++++++++ + + d    +e+ ++k++++l++l+++  +  +lt                  + +++++++l+ f+      + 
  SwissProt::Q9NVE7 451 CFEEALDGVVKRAVASQPDSVDAaerAEKFRQKYWNKLQTLRQQPFAYGTLTVR----------------SLLDTREHCLNEFN------FP 520
                        68899999******99999655566799**************************................**************......** PP

                        -TTHHHHHHHHHHHHHHHHHHHHHHHHCCSHHHHHHHHHHHHHHHCG--CCCHTSHHCHHHHH....HHHHHHHHHCTESEE-HHHHHHHHC CS
              DUF89  90 DpFkeqKeesnksalkaveelakrleeledekelfkellkislwGNaiDlsllateediqkdq....eeearkaleknilvddleklweklk 177
                        Dp++++K+++n  al++++ + ++l++l +e e+  +l+k+ l+GN++D++++a + ++++d+    ee++rk +e+++lvd++++++++lk
  SwissProt::Q9NVE7 521 DPYSKVKQRENGVALRCFPGVVRSLDALGWE-ERQLALVKGLLAGNVFDWGAKAVSAVLESDPyfgfEEAKRKLQERPWLVDSYSEWLQRLK 611
                        ******************************9.**********************9999999999999************************* PP

                        TCHTSEEEEE--BTTHHHHHHHH.HHHHHHHCTTTSEEEEEEBSS--TTTB-BHHHHHHHHHHHH-TTTSHHHHCHTTHHHHHHTSEEEEES CS
              DUF89 178 kkkakrvdivlDNaGfElvfDll.laeeLlesglatkVvlhvkaiPwfvsDvtpeDfewlleqladsksfelsalgagldellkegklvlrg 268
                        ++++k+++i++DN+G++++++++ +++eLl   ++t+V+l++++ P +++Dvt+++  ++ e++a +++     +   l+e  +   lv +g
  SwissProt::Q9NVE7 612 GPPHKCALIFADNSGIDIILGVFpFVRELLL--RGTEVILACNSGP-ALNDVTHSESLIVAERIAGMDPV----VHSALQE--ERLLLVQTG 694
                        *******************************..*************.********************866....4445555..344455555 PP

                        SCGGSSS--CCGSSSHHHHHHHHH..C-SEEEEEHHHHHHHHTTSCTTTTTSEHHHHTGTSS--EEEEEE--SHHHHHHHS CS
              DUF89 269 ssfwttglsysempeapelyeele..kadLvifKGdlNyrkLtgdrkwppttpfttalgfspvpvlaLrtvKadvvaglle 347
                        ss  +++l++s++  ++ l++ ++   adLv+++G+  +r+ ++++++  +++           +l+L+++K+ ++a++l 
  SwissProt::Q9NVE7 695 SS--SPCLDLSRL--DKGLAALVRerGADLVVIEGM--GRAVHTNYHAALRCE-----------SLKLAVIKNAWLAERLG 758
                        55..*********..999999998889*********..************999...........*************9985 PP



Or compare SwissProt::Q9NVE7 to CDD or PaperBLAST