PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9UT55 to PF01937 (DUF89)

SwissProt::Q9UT55 has 438 amino acids

Query:       DUF89  [M=353]
Accession:   PF01937.19
Description: Protein of unknown function DUF89
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   8.4e-126  405.7   0.0   9.5e-126  405.5   0.0    1.0  1  SwissProt::Q9UT55  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9UT55  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  405.5   0.0  9.5e-126  9.5e-126       1     353 []      23     416 ..      23     416 .. 0.98

  Alignments for each domain:
  == domain 1  score: 405.5 bits;  conditional E-value: 9.5e-126
                        HHHTHHHHHHHHHHHHHHH.........HTCCHHHHHHHHHHHHHHHHHHHHCTTCGHHH-HHHH.............T-BTTBSBHHHHHH CS
              DUF89   1 tleerlpciltqviddlek.........akdekeeelkkiieelselkeelqtdkpltpledeee.............krswfnapwlfaec 70 
                        ++ +r+ +ilt++++d+++         +++e ++++k ++++l+++k+++++d+pl ple+e++             + sw+napwl++ec
  SwissProt::Q9UT55  23 CFTRRWGIILTGIEKDVSErlsklastsKDSEVVAQGKPLLNDLEAFKSDIKNDRPLVPLEGEGQdiveyneelkqldNASWGNAPWLYSEC 114
                        6789***************88888876555559***************************99999*************************** PP

                        HHHHHHHHHHTHSGGGTTS-TTHHHHHHHHHHHHHHHHHHHHHHHHCCSH.............HHHHHHHHHHHHHHCG--CCCHT..SHHC CS
              DUF89  71 ylyrrllelfglskelknyDpFkeqKeesnksalkaveelakrleelede.............kelfkellkislwGNaiDlslla..teed 147
                        y yrr++ +f++ +e+k yDpF++qK++++ks+++aveela r++ le+e             ++ f e+ +islwGNa+Dlsll+  ++e+
  SwissProt::Q9UT55 115 YYYRRISLIFARYSEWKAYDPFFQQKDSTLKSSRAAVEELAGRYCLLEEElnsiakkgdshiaYMVFVEMAQISLWGNATDLSLLTnlSYEE 206
                        ******************************************************************************************** PP

                        HHHHHHHHHHHHHHCTESEE-HHHHHHHHCTCHTSEEEEE--BTTHHHHHHHHHHHHHHHCTTTSEEEEEEBSS--TTTB-BHHHHHHHHHH CS
              DUF89 148 iqkdqeeearkaleknilvddleklweklkkkkakrvdivlDNaGfElvfDlllaeeLlesglatkVvlhvkaiPwfvsDvtpeDfewlleq 239
                        +q++q++++ ++++knilv+d++ +w+klk+ +++r+d+vlDNaGfEl++Dl++a +Ll++g+a+++vlh+k++PwfvsDv+p+D+e+ll +
  SwissProt::Q9UT55 207 LQNLQGQKVVEESQKNILVNDFPTVWSKLKDVHNGRIDFVLDNAGFELYVDLIFAAYLLKAGIAKEIVLHPKDFPWFVSDVLPYDIEYLLTN 298
                        ******************************************************************************************** PP

                        HH-TTTS.HHHHCHTTHHHHHHTSEEEEESSCGGSSS--CCGSS.SHHHHHHHHHC-SEEEEEHHHHHHHHTTSCTTTTTSEHHHHT..GTS CS
              DUF89 240 ladsksf.elsalgagldellkegklvlrgssfwttglsysemp.eapelyeelekadLvifKGdlNyrkLtgdrkwppttpfttal..gfs 327
                        l +  ++ ++++++++l+++ ++g+l lr+++fwtt + + +mp  a+ l+ elek+d++ fKGdlNyrkLtgd+ wp+ttpf ++l   ++
  SwissProt::Q9UT55 299 LDTIFPTeSVTKFATDLRSFSAKGQLRLRTDPFWTTAHYFGRMPdFAAGLLTELEKSDMIFFKGDLNYRKLTGDCLWPRTTPFGKTLgpIAN 390
                        ***988789********************************************************************************9** PP

                        S--EEEEEE--SHHHHHHHSTTTHEE CS
              DUF89 328 pvpvlaLrtvKadvvagllegegekl 353
                         ++ +aLrt+Kadvv+gl+ g +ek+
  SwissProt::Q9UT55 391 AINACALRTCKADVVVGLPDGLYEKI 416
                        ********************999985 PP



Or compare SwissProt::Q9UT55 to CDD or PaperBLAST