PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS246273 to PF01937 (DUF89)

VIMSS246273 has 666 amino acids

Query:       DUF89  [M=353]
Accession:   PF01937.19
Description: Protein of unknown function DUF89
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-88  283.6   0.0    1.3e-88  283.3   0.0    1.0  1  VIMSS246273  


Domain annotation for each sequence (and alignments):
>> VIMSS246273  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  283.3   0.0   1.3e-88   1.3e-88       2     352 ..     286     644 ..     285     645 .. 0.93

  Alignments for each domain:
  == domain 1  score: 283.3 bits;  conditional E-value: 1.3e-88
                  HHTHHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHH.HHHHHHCTTCGHHH-HHHH.........T-BTTBSBHHHHHHHHHHHHHHHHTHS..GGGT CS
        DUF89   2 leerlpciltqviddlekakdekeeelkkiieelse.lkeelqtdkpltpledeee.........krswfnapwlfaecylyrrllelfgls..kelk 87 
                  l+er+p++++qv+d+++   +    +l ++++++++ + e l +d+++t  ++++          +rsw+++pwl+ae+++yrrll ++g++  ++++
  VIMSS246273 286 LAERHPALVRQVRDAFPFGPER-LRALDALLASCADgVVEPLPADADPTGRDRDRWarwgmdayaGRSWYDVPWLWAESHFYRRLLDAVGYFgpGAWQ 382
                  689**************95555.8999********999*************88888************************************999*** PP

                  TS-TTHHHHHHHHHHHH.HHHHHHHHHHHHCCSHHHHHHHHHHHHHHHCG--CCCHTSHHCHHHHHHHHHHHHHHCTESEE-HHHHHHHH.......C CS
        DUF89  88 nyDpFkeqKeesnksal.kaveelakrleeledekelfkellkislwGNaiDlsllateediqkdqeeearkaleknilvddleklwekl.......k 177
                    DpF+  K +++++ + +   +  + l+el++e e+ ++ll++slwGN++Dl+++       +d ++  + a+e  ++ dd+++lw+ l       +
  VIMSS246273 383 GVDPFRPAKLAELDAPEtDEELAALDGLDELPTE-ERTRALLHGSLWGNRADLGFRL------SDRGAGTEGAVEA-LVADDSDALWSLLpapgtgpA 472
                  *********966655440444455566******9.**********************......8888888888875.67******************* PP

                  TCHTSEEEEE--BTTHHHHHHHHHHHHHHHCTTTSEEEEEEBSS--TTTB-BHHHHHHHHHHHH-TTTSHHHHCHTTHHHHHHTSEEEEESSCGGSSS CS
        DUF89 178 kkkakrvdivlDNaGfElvfDlllaeeLlesglatkVvlhvkaiPwfvsDvtpeDfewlleqladsksfelsalgagldellkegklvlrgssfwttg 275
                  + ++ ++++v+DNaG Elv Dlll+ +Ll +g+ ++ vlhvk +P++vsD+tp+D+ ++l++l ++  + + a g++l+++l++g++++r+++f++++
  VIMSS246273 473 ERGPATLCLVADNAGRELVPDLLLVSHLLAEGRVDRAVLHVKPYPYYVSDATPTDVLDALRRLVAAGGA-AAAHGERLWTALTDGRVTVRAHPFSCAP 569
                  *****************************************************************9866.9999************************ PP

                  --CCGSSSHHHHHHHHHC-SEEEEEHHHHHHHHTTSCTTTTTSEHHHHTGTSS--EEEEEE--SHHHHHHHSTTTHE CS
        DUF89 276 lsysempeapelyeelekadLvifKGdlNyrkLtgdrkwppttpfttalgfspvpvlaLrtvKadvvagllegegek 352
                  l+y++m  +++l+++++ a++ ++KGdlNyr+L+gdr+wpptt+f+++++++p pv+aLrt+K+dvv gl+++++++
  VIMSS246273 570 LPYADM--PDDLRADFAAATVTVLKGDLNYRRLVGDRWWPPTTSFARVTAYFPGPVAALRTLKSDVVTGLDAKTEAA 644
                  ******..***************************************************************877665 PP



Or compare VIMSS246273 to CDD or PaperBLAST