VIMSS11062 has 139 amino acids
Query: Rv2949c-like [M=149] Accession: PF01947.20 Description: Chorismate pyruvate-lyase Rv2949c-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-54 169.2 0.0 3.3e-54 169.1 0.0 1.0 1 VIMSS11062 Domain annotation for each sequence (and alignments): >> VIMSS11062 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.1 0.0 3.3e-54 3.3e-54 22 149 .] 2 130 .. 1 130 [. 0.98 Alignments for each domain: == domain 1 score: 169.1 bits; conditional E-value: 3.3e-54 Rv2949c-like 22 eliemeaeeseeeeapkeveelkkpllrRqVwlra.sgeklayAeSwwnaeelekylkekdqpiwksltkerlelfReidglalgeadeLeeafgek 117 ++i+m++ + +++ ap +++++++p lrRqVwlr+ sg++layA+Sww+a+++++yl++++ piw+sl++ ++el+R+i+ +++g++++L++afg++ VIMSS11062 2 DVIDMAPVSPRDDGAPPQINTVPGPHLRRQVWLRTkSGQRLAYAVSWWDASHVDEYLQNRSLPIWDSLSRLHTELYRDIQAIYCGHNRTLAKAFGQE 98 79*********************************99************************************************************ PP Rv2949c-like 118 gpfwsRhYrlfhkgkpltvirEvFspalerfl 149 gpfw+RhY+++h++kplt+i+E+Fsp+l+r+l VIMSS11062 99 GPFWGRHYLFWHDRKPLTLIYEIFSPYLSRYL 130 ****************************9986 PP
Or compare VIMSS11062 to CDD or PaperBLAST