biolip::6bwqA has 144 amino acids
Query: Ni_insertion [M=375] Accession: PF01969.21 Description: Nickel insertion protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-51 162.0 0.0 1.3e-51 161.9 0.0 1.0 1 biolip::6bwqA Domain annotation for each sequence (and alignments): >> biolip::6bwqA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 161.9 0.0 1.3e-51 1.3e-51 242 375 .] 2 135 .. 1 135 [. 0.98 Alignments for each domain: == domain 1 score: 161.9 bits; conditional E-value: 1.3e-51 Ni_insertion 242 eeevvvletniDDmtpevlgyvieklleaGAlDvfltpilmKKnRpgvlltvlckeekaeklaeilfretttlGvReseveRlvleReieevetel 337 ++ v+++e+n+DD t+e lgyv+++ll aGA Dvf+tpi+mKK Rp+++ltvl + ++++ l++++++ettt+GvR+++ +R++++R++ +v t++ biolip::6bwqA 2 ADAVLMIEANLDDQTGEGLGYVMNQLLTAGAYDVFFTPIQMKKDRPATKLTVLGNVNDKDLLTKLILQETTTIGVRYQTWQRTIMQRHFLTVATPY 97 57899******************************************************************************************* PP Ni_insertion 338 gevrvKvakekeivkvkpEyedlkkiAeetglplkevy 375 g+v+vKva++++i k pEy d++++A++ ++p+++vy biolip::6bwqA 98 GDVQVKVATYQDIEKKMPEYADCAQLAQQFHIPFRTVY 135 ********9999************************97 PP
Or compare biolip::6bwqA to CDD or PaperBLAST