PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS119812 to PF01973 (MAF_flag10)

VIMSS119812 has 544 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-56  176.9   5.3    1.2e-55  174.0   0.1    3.1  4  VIMSS119812  


Domain annotation for each sequence (and alignments):
>> VIMSS119812  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    3.8   0.1    0.0023    0.0023      84     148 ..       7      72 ..       2      84 .. 0.71
   2 !  174.0   0.1   1.2e-55   1.2e-55       3     170 ..     195     359 ..     193     360 .. 0.92
   3 ?   -2.7   0.0      0.23      0.23      81     124 ..     384     427 ..     378     449 .. 0.66
   4 ?   -0.9   0.1     0.064     0.064      80     124 ..     438     481 ..     431     500 .. 0.72

  Alignments for each domain:
  == domain 1  score: 3.8 bits;  conditional E-value: 0.0023
   MAF_flag10  84 evfkeaekkg..diplvfasgvnpellkkykgpkiflvtgstqalelleeekneilfgGgsvantal 148
                  + +++ +k+     +++  s +n+++lk +k  k +++ +++ a++ +e+ +n+ ++ G+ ++ +++
  VIMSS119812   7 NSIEKSKKENleVNYVIEKSKDNKNVLKVIKDGKSMYMGSKYNASRDIEDIFNK-IEDGHKDIAVIF 72 
                  5555555554534567778999*********99998888888887777666665.677777766655 PP

  == domain 2  score: 174.0 bits;  conditional E-value: 1.2e-55
   MAF_flag10   3 llknlkenlk.pslkellnkfkgnkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplvf 99 
                  ++knl ++ k +++ +l n fkg  pa+iv+aGPSLekn+++lke+++k+vii+ +++lk+Ll+ gI PD+v+++Dp ++ y+++k+++++   plv+
  VIMSS119812 195 YVKNLRYIVKsTPVYYLNNLFKG-LPAVIVSAGPSLEKNISYLKEYQNKCVIISGGRTLKPLLELGISPDFVCIIDPADIAYQQIKDYDYS-RFPLVY 290
                  689*******999**********.******************************************************************9.****** PP

   MAF_flag10 100 asgvnpellkkykgpki.flvtgstqalelleeekne...ilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                  ++ +n ++++++kg+ki +++++  +  +ll    +     l+ Ggsva+ +l lAvklg+++Ii+iGqD+ayt+
  VIMSS119812 291 FEKTNWRVVENHKGNKIiNSYDE-NL-KRLL----GTdvgALDHGGSVAHNCLGLAVKLGCNPIIMIGQDFAYTN 359
                  *****************444433.22.4444....333467********************************98 PP

  == domain 3  score: -2.7 bits;  conditional E-value: 0.23
   MAF_flag10  81 asyevfkeaekkgdiplvfasgvnpellkkykgpki.flvtgstq 124
                  +  +vf e+ k  d++l ++  + +e +k y+ + + ++++g+++
  VIMSS119812 384 YVKDVFGEMVKT-DSVLNMYRKTMEEMIKIYSDREYiNCTEGGAY 427
                  555667777777.77777777778888888887777555555554 PP

  == domain 4  score: -0.9 bits;  conditional E-value: 0.064
   MAF_flag10  80 easyevfkeaekkgdiplvfasgvnpellkkykgpkiflvtgstq 124
                  ++ ++++k + +k di  vf  + n ++   +k+ k  l +g  +
  VIMSS119812 438 KVLHNHCKSILNK-DISSVFLKSNNVKVSGVIKELKNTLKEGEKI 481
                  5677889999998.9999999999999888888887766665544 PP



Or compare VIMSS119812 to CDD or PaperBLAST