PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS119818 to PF01973 (MAF_flag10)

VIMSS119818 has 592 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-50  157.2   0.0    1.7e-50  157.2   0.0    3.6  5  VIMSS119818  


Domain annotation for each sequence (and alignments):
>> VIMSS119818  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.2     0.017     0.017      89     128 ..      12      54 ..       3      69 .. 0.62
   2 ?   -0.9   0.0     0.063     0.063      84     120 ..      57      92 ..      48     130 .. 0.59
   3 !  157.2   0.0   1.7e-50   1.7e-50       2     170 ..     192     361 ..     191     362 .. 0.92
   4 ?   -3.8   0.0       0.5       0.5      94     117 ..     394     418 ..     374     433 .. 0.59
   5 ?   -0.0   0.1     0.035     0.035      14      46 ..     553     591 ..     534     592 .] 0.66

  Alignments for each domain:
  == domain 1  score: 1.0 bits;  conditional E-value: 0.017
   MAF_flag10  89 aekkgdiplvfasgvnpellkkykgpkiflvtgstqa...lel 128
                  +++k++ + +  s++n++++k  k++k +++ +++ +   ++ 
  VIMSS119818  12 LDNKEEQYCIEKSTDNKNIIKVEKNKKNIYLGSKYNVkkdIDK 54 
                  4444467778888889999987777777656655555444333 PP

  == domain 2  score: -0.9 bits;  conditional E-value: 0.063
   MAF_flag10  84 evfkeaekkgdiplvfasgvnpellkkykgpkiflvt 120
                  + + +++k+ +i ++f+ g+ +++ + +k +  +++ 
  VIMSS119818  57 NEMGDYNKE-SIFVCFGLGAGEHIKELLKITENNIIV 92 
                  446666776.888888777655554444433332222 PP

  == domain 3  score: 157.2 bits;  conditional E-value: 1.7e-50
   MAF_flag10   2 nllknlkenlk.pslkellnkfkgnkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplv 98 
                  +++ nlk++l+   +++l+++++++ p+++v+aGPSLekn+ +lk+++dk++ii+ +++lk+Ll+ +IkPD+v+ +Dp+   y+v+ ++ ++  +pl+
  VIMSS119818 192 SFMGNLKYILDsVAVNKLKSNYNKDMPVVVVSAGPSLEKNIRFLKDCQDKCIIITGGRTLKTLLDLDIKPDYVCVVDPDVPAYDVMRGTFDC-TAPLL 288
                  7899*******999******99667*******************************************************************.***** PP

   MAF_flag10  99 fasgvnpellkkykgpkiflvtgstqalelleeekne...ilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                  f++ +++e+l++ykg+kif+++ +++   l +e  n+   ++f+Ggsva+++  l v++g ++Ii+iGqDlayt+
  VIMSS119818 289 FCEYTYYEILRDYKGEKIFFNDIGML--GLQKEFLNYdvdNIFEGGSVAHVCAGLGVYIGGDPIIFIGQDLAYTN 361
                  ******************98886554..44444455556799*******************************98 PP

  == domain 4  score: -3.8 bits;  conditional E-value: 0.5
   MAF_flag10  94 diplvfasgvnpellkkykgpki.f 117
                  d++l f+ +  +e  + +k++++ +
  VIMSS119818 394 DSVLNFYRIKLEEMTQLFKENNFiN 418
                  6666666666666666666666633 PP

  == domain 5  score: -0.0 bits;  conditional E-value: 0.035
   MAF_flag10  14 slkellnkfkg......nkpaiivgaGPSLeknlellke 46 
                  + +++++ +k+        +  i  aGP +ek ++ lke
  VIMSS119818 553 EKEKIKRVYKKnillynGIKTSIMEAGPEIEKCIKSLKE 591
                  334444433222555556888899999999999999986 PP



Or compare VIMSS119818 to CDD or PaperBLAST