PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS18885 to PF01973 (MAF_flag10)

VIMSS18885 has 631 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.8e-33  100.4   3.2    3.1e-32   97.8   0.0    3.1  3  VIMSS18885  


Domain annotation for each sequence (and alignments):
>> VIMSS18885  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.1      0.13      0.13      96     135 ..      26      66 ..      13      84 .. 0.57
   2 !   97.8   0.0   3.1e-32   3.1e-32       2     170 ..     261     419 ..     258     420 .. 0.87
   3 ?    1.6   0.1     0.011     0.011      85     124 ..     447     486 ..     433     510 .. 0.77

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.13
  MAF_flag10  96 plvfasgvnpellkkykgpkiflvtgstqa.lelleeekne 135
                  lvf+ + np+l+++++ p +++   + ++ ++ll++  n+
  VIMSS18885  26 NLVFFKSYNPNLFNALNTPFKNYQLLFEKNhFNLLHTPTNA 66 
                 57777788888888887777754443333345555554444 PP

  == domain 2  score: 97.8 bits;  conditional E-value: 3.1e-32
  MAF_flag10   2 nllknlkenlkpslkellnkfkg.nkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplvf 99 
                 n+lknl+ ++      l+ k k+ n p+++vg+GPSL+  l++lke++++++i++++talk+L  +g+k+D+ +++++ ++  ev+++a  + d+pl+ 
  VIMSS18885 261 NTLKNLPLYQ-----TLKIKPKKiNAPICVVGNGPSLDLLLDFLKENEKNCIIFSCGTALKPLKTHGVKVDFQIEVERIDYLKEVLENAPLE-DTPLMG 353
                 5555555444.....4555556679*****************************************************99999999999998.****** PP

  MAF_flag10 100 asgvnpellkkykgpkiflvtgstqa..lelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                 a++ np++++  k+ ++f++ gs+ a  ++l       i +  + v+n+ ++lA  l  +eI+l+ +D+ay +
  VIMSS18885 354 ANMLNPNAFNVAKEALMFMRGGSACAyiSPLS------IEYAAPLVGNAGVALA-GLMSDEIYLCALDCAYIK 419
                 *****************999988754423333......689*************.6778************76 PP

  == domain 3  score: 1.6 bits;  conditional E-value: 0.011
  MAF_flag10  85 vfkeaekkgdiplvfasgvnpellkkykgpkiflvtgstq 124
                  fk++e+++d++++ +    +e+l++y+++k++ ++ +++
  VIMSS18885 447 NFKGYETFSDSLFLLSKERIEEALNHYQPKKVYNLSYGAK 486
                 48999999999********************975554444 PP



Or compare VIMSS18885 to CDD or PaperBLAST