PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS202367 to PF01973 (MAF_flag10)

VIMSS202367 has 441 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-46  144.8   0.0    8.3e-46  142.0   0.0    2.0  2  VIMSS202367  


Domain annotation for each sequence (and alignments):
>> VIMSS202367  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    4.5   0.0    0.0014    0.0014      49     119 ..     123     192 ..     115     194 .. 0.79
   2 !  142.0   0.0   8.3e-46   8.3e-46       2     170 ..     183     352 ..     182     353 .. 0.92

  Alignments for each domain:
  == domain 1  score: 4.5 bits;  conditional E-value: 0.0014
   MAF_flag10  49 dkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplvfasgvnpellkkykgpkiflv 119
                   ++v+ a+ +a+    +  I+PD+ +  D + +  + +  +e ++d +  +  ++ pe+lk++  +++f++
  VIMSS202367 123 PNVVLNAIPSATLQFPNIAITPDLNLVSDDNATLRD-LLVMELNRDFTNRHHQIDDPEILKRFADNQVFIT 192
                  5778888888888888999********999555555.555554459******************9999875 PP

  == domain 2  score: 142.0 bits;  conditional E-value: 8.3e-46
   MAF_flag10   2 nllknlkenlk.pslkellnkfkgnkpaiivgaGPSLeknlellkelr...dkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdi 95 
                  ++++n   +++ p++++l+++++   +ai++g+GPSLe+++++lk+l    ++ ++iaadtal+ Ll+++IkPDivv++D+  +sy++    ++  +i
  VIMSS202367 183 RFADNQVFITNdPDAAHLTKSYNP-YKAIVIGSGPSLEEHYAYLKQLSlspSRPLLIAADTALRGLLHHQIKPDIVVCIDGLISSYHLPLSETQ--EI 277
                  788999999999********9999.**************************************************************6666555..8* PP

   MAF_flag10  96 plvfasgvnpellkkykgpkiflvtgstqalelleeekne.ilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                   lv++++v pe+l+++ gp+++++ +s + ++ +++ + + +lf+ gsv+++a+dlAvkl++keI+l+G+D++y +
  VIMSS202367 278 NLVYFPRVAPEVLAHWLGPRFVAYGTSKI-YDSMSQLNPKlRLFTNGSVIHPAIDLAVKLHAKEITLLGCDFCYCN 352
                  *********************99998888.555545555579********************************87 PP



Or compare VIMSS202367 to CDD or PaperBLAST