PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS25995 to PF01973 (MAF_flag10)

VIMSS25995 has 210 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.4e-24   70.9   0.0      1e-22   66.8   0.0    2.0  2  VIMSS25995  


Domain annotation for each sequence (and alignments):
>> VIMSS25995  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    2.2   0.0    0.0074    0.0074      87     143 ..      33      89 ..      17      94 .. 0.66
   2 !   66.8   0.0     1e-22     1e-22      10      84 ..     108     180 ..      99     194 .. 0.84

  Alignments for each domain:
  == domain 1  score: 2.2 bits;  conditional E-value: 0.0074
  MAF_flag10  87 keaekkgdiplvfasgvnpellkkykgpkiflvtgstqalelleeekneilfgGgsv 143
                  + + +++i  ++ ++++ + + +y +p++ ++ +s q ++ l ++  +i++  +sv
  VIMSS25995  33 THGSASQEIAQCYMPIIHGNFFVHYLQPWKAFFPTSEQKIAELTSQAMKIIRADFSV 89 
                 33344449**********************777777776444433333345555555 PP

  == domain 2  score: 66.8 bits;  conditional E-value: 1e-22
  MAF_flag10  10 nlkpslkellnkfkgnkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasye 84 
                  +   + +l n + + ++aii+gaGPSLek +e+++ +rd ++i+a+dta++++   g+ PD+++s+Dpq +sy 
  VIMSS25995 108 AQI-FTPKLPNINTQ-TEAIILGAGPSLEKGIEKIRSHRDVYTIFACDTAFPVCCTGGLMPDFFISIDPQYISYA 180
                 433.33444443345.9*****************************************************99997 PP



Or compare VIMSS25995 to CDD or PaperBLAST