PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS27271 to PF01973 (MAF_flag10)

VIMSS27271 has 631 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.2e-33  101.5   3.1    5.5e-33  100.2   0.0    3.0  5  VIMSS27271  


Domain annotation for each sequence (and alignments):
>> VIMSS27271  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.1      0.13      0.13      96     151 ..      26      82 ..      12      84 .. 0.61
   2 ?   -2.1   0.0      0.15      0.15      75     111 ..      92     137 ..      91     160 .. 0.64
   3 !  100.2   0.0   5.5e-33   5.5e-33       2     170 ..     261     419 ..     258     420 .. 0.87
   4 ?   -1.5   0.1     0.095     0.095      86     124 ..     448     486 ..     436     512 .. 0.71
   5 ?   -2.0   0.1      0.14      0.14      78     118 ..     495     536 ..     481     558 .. 0.56

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.13
  MAF_flag10  96 plvfasgvnpellkkykgpkiflvtgstqa.lelleeekneilfgGgsvantaldlA 151
                  lvf+ + +p+l+++++ p +++   +  + l+ll++  n+  +  +  ++ta+ +A
  VIMSS27271  26 NLVFFKSYHPNLFNALNTPFKNYQLLFETNhLNLLHTPTNALSYPKHQMIETAFNMA 82 
                 577888888888888888877433333322466666666665666666666666666 PP

  == domain 2  score: -2.1 bits;  conditional E-value: 0.15
  MAF_flag10  75 slDpqeasyevfkeaekkg.........diplvfasgvnpellkky 111
                 slD++++s +++k  ++++          i  + +++  p  lkk+
  VIMSS27271  92 SLDNNHLSLHYLKSQNNHKlpltlkathAISNFLDNHQTPCSLKKF 137
                 6888888888888888876555555444444444555555555555 PP

  == domain 3  score: 100.2 bits;  conditional E-value: 5.5e-33
  MAF_flag10   2 nllknlkenlkpslkellnkfkg.nkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplvf 99 
                 n+lknl+       + l+ k k+ n p+++vg+GPSL+  l++lke+++k++i++++talk+L  +g+k+D+ +++++ ++  ev++ a  + d+pl+ 
  VIMSS27271 261 NTLKNLP-----LYQTLKTKPKKiNAPICVVGNGPSLDLLLDFLKENEEKFIIFSCGTALKPLKAHGVKVDFQIEVERIDYLKEVLERAPLE-DTPLMG 353
                 4455555.....4455777777789*****************************************************99999988888888.****** PP

  MAF_flag10 100 asgvnpellkkykgpkiflvtgstqa..lelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                 a++ np+++   k+ ++f++ gs+ a  ++l       i +  + v+n+ ++lA  l  +eI+l+ +D+ay +
  VIMSS27271 354 ANMLNPNAFDLAKEALMFMRGGSACAyiSPLS------IEYAAPFVGNAGVALA-GLMSDEIYLCALDCAYIK 419
                 *****************999998854423333......689*************.6778************76 PP

  == domain 4  score: -1.5 bits;  conditional E-value: 0.095
  MAF_flag10  86 fkeaekkgdiplvfasgvnpellkkykgpkiflvtgstq 124
                 ++++e+++d++++ +    +e+l  y+++k++ ++ +++
  VIMSS27271 448 VEGYETFSDSLFLLSKERIEEALHYYQPKKVYNLSYGAK 486
                 566777778888888888889999999999865544443 PP

  == domain 5  score: -2.0 bits;  conditional E-value: 0.14
  MAF_flag10  78 pqeasyevfkeaekkgdiplvfasgvnpel.lkkykgpkifl 118
                  ++++ +++++ +    i  +f++++n+ + lk++++++i +
  VIMSS27271 495 HSQVKLKQINKQDAIVRIKSMFSPRSNHAKdLKNLQKNLIRF 536
                 434444444443333366666666655533266666666643 PP



Or compare VIMSS27271 to CDD or PaperBLAST