PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3564198 to PF01973 (MAF_flag10)

VIMSS3564198 has 779 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-39  121.4   0.0    2.6e-39  120.8   0.0    1.3  1  VIMSS3564198  


Domain annotation for each sequence (and alignments):
>> VIMSS3564198  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  120.8   0.0   2.6e-39   2.6e-39       2     170 ..     533     702 ..     532     703 .. 0.89

  Alignments for each domain:
  == domain 1  score: 120.8 bits;  conditional E-value: 2.6e-39
    MAF_flag10   2 nllknlkenlk.pslkellnkfkgnkpaiivgaGPSLeknlellkelr...dkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgd 94 
                   ++ +nl+ +++ ++++ l+ ++kg ++a+++++GP+L ++ e lk++r   d+ + i++dtal++Ll++ I+PDivv++D++ +s  +  + ++  d
  VIMSS3564198 533 RFDENLALLRQdQDVAALFGTMKG-REAYVLATGPTLASHFERLKQVReqaDRPMFICVDTALRPLLEQEIRPDIVVTVDRNIHSGILHPDWSH--D 626
                   6778999999999***********.**********************99999*****************************6666654444444..9 PP

    MAF_flag10  95 iplvfasgvnpellkkykgpkiflvtgstqalelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                   i lv+ ++v + +l++++gp++ ++++   + +l ++  +++lf+Ggsv+++a dlAv++g+ +++l+G D++y+ 
  VIMSS3564198 627 IKLVYMPMVDNGVLASWQGPRYGAYEALDTYVRLSRKLRRASLFTGGSVIHPATDLAVRMGAGQVTLFGADFSYPG 702
                   **********************7777766655555445555********************************975 PP



Or compare VIMSS3564198 to CDD or PaperBLAST