PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS47215 to PF01973 (MAF_flag10)

VIMSS47215 has 605 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.4e-48  150.2   1.5    2.8e-48  150.0   0.2    1.8  2  VIMSS47215  


Domain annotation for each sequence (and alignments):
>> VIMSS47215  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.0   0.2   2.8e-48   2.8e-48       2     170 ..     204     374 ..     203     375 .. 0.91
   2 ?   -3.8   0.1      0.49      0.49      60      92 ..     507     539 ..     506     549 .. 0.70

  Alignments for each domain:
  == domain 1  score: 150.0 bits;  conditional E-value: 2.8e-48
  MAF_flag10   2 nllknlkenlk.pslkellnkfkg.nkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplv 98 
                 ++l+n++++l+  +++++l++ k+  ++ai+v+aGPSL k+l+llk+++dkavi++ad+al++L+kegI+PD+v++lD +++ +++f++ e+ ++++++
  VIMSS47215 204 QFLQNIPSMLEsIPFQRILSERKNkFENAIVVSAGPSLAKQLPLLKAYQDKAVIFCADGALSMLEKEGIIPDYVTNLDFTDLAMKFFQNKENLKQSIIA 302
                 689********988999999777768************************************************************************* PP

  MAF_flag10  99 fasgvnpellkkykgpki.flvtgstqalelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                     ++p+++++++ +++ +++++++++ ++  +++++ +++G  v+++++ lA+ lgfk+Ii+iGqDla+ +
  VIMSS47215 303 LECATHPNIVRSLNAENCmIVLRNKALYQRFNLNDFGY-IDTGTHVSHFSYTLALALGFKNIIMIGQDLAFDE 374
                 ******************55555555544444445555.8******************************976 PP

  == domain 2  score: -3.8 bits;  conditional E-value: 0.49
  MAF_flag10  60 lkaLlkegIkPDivvslDpqeasyevfkeaekk 92 
                 lk  l++ +  D+++ l+  e  y+ +++++++
  VIMSS47215 507 LKQILENILSKDFILPLEFLEKVYQNIENFNHS 539
                 566666666777777777777777777776664 PP



Or compare VIMSS47215 to CDD or PaperBLAST