PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS47216 to PF01973 (MAF_flag10)

VIMSS47216 has 607 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      2e-46  143.9   0.1    5.2e-46  142.6   0.1    1.7  1  VIMSS47216  


Domain annotation for each sequence (and alignments):
>> VIMSS47216  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.6   0.1   5.2e-46   5.2e-46       2     170 ..     204     371 ..     203     372 .. 0.91

  Alignments for each domain:
  == domain 1  score: 142.6 bits;  conditional E-value: 5.2e-46
  MAF_flag10   2 nllknlkenlk.pslkellnkfkg.nkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplv 98 
                 +ll+n++++l+  +++++l++ k+  ++ai+v+aGPSL k+l+llk+++dkavi++ad+al++L+kegI+PD+v++lD +++ +++f++ e+k  ++ +
  VIMSS47216 204 HLLQNIPSMLEsIPFQRILSERKNkFENAIVVSAGPSLAKQLPLLKAYQDKAVIFCADGALSMLEKEGIIPDYVTNLDFTDLAMKFFQNKENK-TSLNM 301
                 89*********988999999777778******************************************************************9.99999 PP

  MAF_flag10  99 fasgvnpellkkykgpkiflvtgstqalelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                  +  ++p l+  +++++++l++   +  ++  +++++ +++G  v+++++ lA+ lgfk+Ii+iGqDla+ +
  VIMSS47216 302 LSCATHPSLVHFLDNKSVVLRDDPLY-QRFNLNDFGY-IDTGTHVSHFSYTLALALGFKNIIMIGQDLAFDE 371
                 9999******9999999987776443.4444456666.8******************************976 PP



Or compare VIMSS47216 to CDD or PaperBLAST