PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS575755 to PF01973 (MAF_flag10)

VIMSS575755 has 507 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-41  127.7   0.0    4.1e-41  126.7   0.0    1.5  1  VIMSS575755  


Domain annotation for each sequence (and alignments):
>> VIMSS575755  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  126.7   0.0   4.1e-41   4.1e-41       2     170 ..     199     368 ..     195     369 .. 0.87

  Alignments for each domain:
  == domain 1  score: 126.7 bits;  conditional E-value: 4.1e-41
   MAF_flag10   2 nllknlkenlkpslkellnkfkgnkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkgdiplvf 99 
                  n+++nlk+     + +++ k   +k+a+i+gaGPSLe+ le++k++rd++v++a+dta+++L+++gI+ D++v++Dpq++sy ++ +  +k +++ +f
  VIMSS575755 199 NIMQNLKTASL--IRPFIPKTDPSKKAYILGAGPSLESALENIKKYRDSIVLFASDTAFPVLISAGIEADFFVTMDPQNISYAHCFKPFTK-STVGIF 293
                  44445554444..66666655348************************************************************9999998.****** PP

   MAF_flag10 100 asgvnpellkkykgpki.flvtgstqa...lelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                  + ++np l +++ ++   f++t+s++    ++ + + + ++ +g+g+va +a + A++lgfk++ ++G+D+ayt 
  VIMSS575755 294 DLCSNPILAREFLKNGNsFFFTKSAHPfaqYASFFSPFPYMETGSGTVALAARSAALSLGFKDLEFFGLDFAYTG 368
                  ************999999999999998677444446666799*******************************85 PP



Or compare VIMSS575755 to CDD or PaperBLAST