PaperBLAST – Find papers about a protein or its homologs

 

Align WP_012663848.1 to PF01973 (MAF_flag10)

WP_012663848.1 has 643 amino acids

Query:       MAF_flag10  [M=171]
Accession:   PF01973.18
Description: Protein of unknown function DUF115
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.7e-48  150.0   0.5    9.3e-48  148.3   0.5    2.0  1  WP_012663848.1  


Domain annotation for each sequence (and alignments):
>> WP_012663848.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  148.3   0.5   9.3e-48   9.3e-48       2     170 ..     209     378 ..     208     379 .. 0.93

  Alignments for each domain:
  == domain 1  score: 148.3 bits;  conditional E-value: 9.3e-48
      MAF_flag10   2 nllknlkenlk.pslkellnkfkgnkpaiivgaGPSLeknlellkelrdkaviiaadtalkaLlkegIkPDivvslDpqeasyevfkeaekkg.. 93 
                     ++++n++++lk p +++l+nk +  + aiiv++GPSL k+l+llk+++++a++i++d+++++L k+gI+PD+v+sl++ +a++++fk++  k+  
  WP_012663848.1 209 HHINNIPTMLKnPYFSQLENKKNT-DVAIIVSTGPSLAKQLPLLKKIQNHATLICIDASMPILAKHGIVPDFVTSLERVQATAKFFKNTPPKFqk 302
                     789*********99******5555.9***************************************************************999899 PP

      MAF_flag10  94 diplvfasgvnpellkkykgpkiflvtgstqalelleeekneilfgGgsvantaldlAvklgfkeIiliGqDlaytd 170
                     +i++++as  ++++lk  kg+ki  ++++ ++  +  ++++  l+ G+s an+a++lA+ ++ k+I+liGqDlay++
  WP_012663848.1 303 NIIMLHASLQHKDVLKYSKGKKILPMRPFRHTKYFKLDKFG-YLGIGMSAANMAYELAYFMKYKTIVLIGQDLAYSE 378
                     ***********************989999985444444444.5********************************97 PP



Or compare WP_012663848.1 to CDD or PaperBLAST