PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P58557 to PF02130 (UPF0054)

SwissProt::P58557 has 167 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.4e-34  104.9   0.0    1.6e-34  104.7   0.0    1.0  1  SwissProt::P58557  


Domain annotation for each sequence (and alignments):
>> SwissProt::P58557  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.7   0.0   1.6e-34   1.6e-34      16     128 .]      27     148 ..      11     148 .. 0.89

  Alignments for each domain:
  == domain 1  score: 104.7 bits;  conditional E-value: 1.6e-34
            UPF0054  16 eealkkekle..evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeee.ee..........lGDivisvekakeqaeeyghslerelaf 94 
                        +++l    ++  ++ ++ vdn++i+++n+ yr+++ pTDVLSFp++e+ +  e           lGDi++ ve++ +q++e ++ +++ l++
  SwissProt::P58557  27 RRILG---VQkfDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAgEFpqpdfpddynLGDIFLGVEYIFHQCKE-NEDYNDVLTV 114
                        34443...334589*********************************9999533889************************.9999****** PP

            UPF0054  95 llvHgllHllGYDHeeeeeekeMeekeeeileel 128
                         ++Hgl+HllG+ H +e+e+++M++ke+++l+el
  SwissProt::P58557 115 TATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDEL 148
                        *******************************986 PP



Or compare SwissProt::P58557 to CDD or PaperBLAST