PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1142169 to PF02130 (UPF0054)

VIMSS1142169 has 167 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.9e-36  109.6   0.0      6e-36  109.3   0.0    1.0  1  VIMSS1142169  


Domain annotation for each sequence (and alignments):
>> VIMSS1142169  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.3   0.0     6e-36     6e-36       8     127 ..      20     160 ..      14     161 .. 0.91

  Alignments for each domain:
  == domain 1  score: 109.3 bits;  conditional E-value: 6e-36
       UPF0054   8 eklikkvleealkkekle....evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeee.................lGDivisvekakeqaee 83 
                    +l+++++e++l +++++     + v+ +d+++i+eln  +r+k kpT+VLS+p ee  +ee                  lGD+ i++e+++++a e
  VIMSS1142169  20 PALATRAAEATLAALDMPaegfTLVVMGCDDARIAELNGAFRQKGKPTNVLSWPSEERASEEPgmapeppepgdpedpepLGDVAIAFETCQREAAE 116
                   5667777788887666667788999********************************9999447899****************************** PP

       UPF0054  84 yghslerelafllvHgllHllGYDHeeeeeekeMeekeeeilee 127
                   +g+ +++++++llvHg+lHllGYDH ee++   Me+ e++il+ 
  VIMSS1142169 117 QGKPVTDHVTHLLVHGVLHLLGYDHVEEADGDLMEATETRILAG 160
                   *****************************************975 PP



Or compare VIMSS1142169 to CDD or PaperBLAST