PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS116447 to PF02130 (UPF0054)

VIMSS116447 has 165 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-45  138.3   2.5    8.2e-45  138.0   2.5    1.0  1  VIMSS116447  


Domain annotation for each sequence (and alignments):
>> VIMSS116447  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  138.0   2.5   8.2e-45   8.2e-45       4     127 ..      13     159 ..      10     160 .. 0.92

  Alignments for each domain:
  == domain 1  score: 138.0 bits;  conditional E-value: 8.2e-45
      UPF0054   4 eedleklikkvleealkkekle..evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeee.....................lGDivisvekak 78 
                  ++++ + ++++le a++k++ e  e+ v++v+ne+ +eln eyr+ d+pTDV+S++++ e e                        +G+++is++ka+
  VIMSS116447  13 SKEMLQQTQEILEFAAQKLGKEdkEMAVTFVTNERSHELNLEYRNTDRPTDVISLEYKPELEIAFdeedllenselaemmsefdayIGELFISIDKAH 110
                  567778888899999987777688*********************************999998225679***************************** PP

      UPF0054  79 eqaeeyghslerelafllvHgllHllGYDHeeeeeekeMeekeeeilee 127
                  eqaeeyghs+ere++fl+vHg+lH+ GYDH ++eee+eM++++eeil++
  VIMSS116447 111 EQAEEYGHSFEREMGFLAVHGFLHINGYDHYTPEEEAEMFGLQEEILTA 159
                  **********************************************986 PP



Or compare VIMSS116447 to CDD or PaperBLAST