VIMSS116447 has 165 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-44 136.4 2.2 3.4e-44 136.1 2.2 1.1 1 VIMSS116447 Domain annotation for each sequence (and alignments): >> VIMSS116447 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 136.1 2.2 3.4e-44 3.4e-44 4 128 .. 13 159 .. 10 160 .. 0.94 Alignments for each domain: == domain 1 score: 136.1 bits; conditional E-value: 3.4e-44 YbeY 4 eeeleklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee.......................lGDivisveka 78 ++e+ ++++++le a++++ k++ e+ v++v+ne+ +eln eyrn+d+pTDV+S +++ e e +G+++is++ka VIMSS116447 13 SKEMLQQTQEILEFAAQKL-GKEDKEMAVTFVTNERSHELNLEYRNTDRPTDVISLEYKPELEIafdeedllenselaemmsefdayIGELFISIDKA 109 5677788889999988844.47788*********************************9999989********************************* PP YbeY 79 eeqaeeyghslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilkk 128 +eqaeeyghs+ere++fl+vHg+LH+ GYDH ++eee+eM+ ++eeil++ VIMSS116447 110 HEQAEEYGHSFEREMGFLAVHGFLHINGYDHYTPEEEAEMFGLQEEILTA 159 ***********************************************986 PP
Or compare VIMSS116447 to CDD or PaperBLAST