PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1290097 to PF02130 (UPF0054)

VIMSS1290097 has 155 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.7e-52  160.7   0.6      9e-52  160.5   0.6    1.0  1  VIMSS1290097  


Domain annotation for each sequence (and alignments):
>> VIMSS1290097  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  160.5   0.6     9e-52     9e-52       6     127 ..      16     149 ..      12     150 .. 0.93

  Alignments for each domain:
  == domain 1  score: 160.5 bits;  conditional E-value: 9e-52
       UPF0054   6 dleklikkvleealkkekle...evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeee..........lGDivisvekakeqaeeyghsle 89 
                    + k i+++le a k+e++e   e+sv++vd++ei+e+n++yr+kdk+TDV+SF+lee+e e            lGDi+i++++a+eqa++yghs+e
  VIMSS1290097  16 AWYKQIEDLLEFAKKEEHIEddaELSVTFVDKQEIQEINRTYRDKDKVTDVISFALEEDEPE-IdfsgldiprvLGDIIICTDVAQEQANNYGHSFE 111
                   5667888999999999999999***********************************99988.235899**************************** PP

       UPF0054  90 relafllvHgllHllGYDHeeeeeekeMeekeeeilee 127
                   rel+fl+ Hg+lHllGYDH++e++ekeM+++++ il++
  VIMSS1290097 112 RELGFLALHGFLHLLGYDHMTEADEKEMFGRQDTILNA 149
                   ************************************97 PP



Or compare VIMSS1290097 to CDD or PaperBLAST