PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS157689 to PF02130 (UPF0054)

VIMSS157689 has 161 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.9e-50  154.0   0.5      1e-49  153.8   0.5    1.0  1  VIMSS157689  


Domain annotation for each sequence (and alignments):
>> VIMSS157689  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.8   0.5     1e-49     1e-49       6     127 ..      18     156 ..      13     157 .. 0.95

  Alignments for each domain:
  == domain 1  score: 153.8 bits;  conditional E-value: 1e-49
      UPF0054   6 dleklikkvleealkkekle...evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeee..............lGDivisvekakeqaeeygh 86 
                  + ++l++++l+ a++++k+e   e+s+++++ne ire+n+eyr+kd++TDV+SF+lee ++ e               lGDi+is+eka+eqa+ ygh
  VIMSS157689  18 EDKQLVENILQFAAEYLKIEqgtELSLTFTTNEGIREINREYRDKDQATDVISFALEEMGDGETeidwgefdletprmLGDIIISTEKAEEQAKDYGH 115
                  56889999999999999999999**************************************944689******************************* PP

      UPF0054  87 slerelafllvHgllHllGYDHeeeeeekeMeekeeeilee 127
                  + +rel+fl+vHgllHllGYDH+e++eek+M+++++e+l++
  VIMSS157689 116 TKARELGFLAVHGLLHLLGYDHMEPDEEKVMFGLQKEVLDA 156
                  **************************************997 PP



Or compare VIMSS157689 to CDD or PaperBLAST