PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS19571 to PF02130 (UPF0054)

VIMSS19571 has 140 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    3.6e-34  103.6   0.0    4.1e-34  103.4   0.0    1.0  1  VIMSS19571  


Domain annotation for each sequence (and alignments):
>> VIMSS19571  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.4   0.0   4.1e-34   4.1e-34      25     126 ..      28     126 ..       6     128 .. 0.85

  Alignments for each domain:
  == domain 1  score: 103.4 bits;  conditional E-value: 4.1e-34
     UPF0054  25 eevsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeeelGDivisvekakeqaeeyghslerelafllvHgllHllGYDHeeeeeekeMeekeee 123
                 + ++++lv++e+ire+nk+ rg d++TDVLSFple   ++  lG +vi  + a+ +a + ghsle+e+a+l++Hg+lHllGYDHe+++ e+  ++ke e
  VIMSS19571  28 QIIELVLVSDETIREINKDLRGCDYATDVLSFPLEAIPHT-PLGSVVINAPLAQTNALKLGHSLENEIALLFIHGVLHLLGYDHEKDKGEQ--RQKESE 123
                 3799********************************9998.9******************************************9666555..666666 PP

     UPF0054 124 ile 126
                 +++
  VIMSS19571 124 LIK 126
                 665 PP



Or compare VIMSS19571 to CDD or PaperBLAST