VIMSS34140 has 182 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-41 125.6 0.0 9.7e-41 124.9 0.0 1.3 1 VIMSS34140 Domain annotation for each sequence (and alignments): >> VIMSS34140 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 124.9 0.0 9.7e-41 9.7e-41 12 128 .. 24 152 .. 15 153 .. 0.94 Alignments for each domain: == domain 1 score: 124.9 bits; conditional E-value: 9.7e-41 YbeY 12 kkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee............lGDivisvekaeeqaeeyghslerelafllv 98 +v++ ++++++++ aels+ll+d++++++l+ ++++ pTDV+SFp++e e lGDiv+++e a+eqa+ +ghsl +ela+l++ VIMSS34140 24 VSVARFVIAKMDVNPCAELSMLLLDTAAMADLHMRWMDLPGPTDVMSFPMDELEPGgrpdapepgpsmLGDIVLCPEFAAEQAAAAGHSLGHELALLTI 122 45568888999******************************************999******************************************* PP YbeY 99 HglLHLlGYDHeeeeeekeMeekeeeilkk 128 Hg+LHLlGYDH e++eekeM+++++++l++ VIMSS34140 123 HGVLHLLGYDHAEPDEEKEMFALQDRLLEE 152 **************************9985 PP
Or compare VIMSS34140 to CDD or PaperBLAST