PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3531803 to PF02130 (UPF0054)

VIMSS3531803 has 158 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.1e-45  140.8   4.7    1.2e-45  140.7   4.7    1.0  1  VIMSS3531803  


Domain annotation for each sequence (and alignments):
>> VIMSS3531803  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  140.7   4.7   1.2e-45   1.2e-45       3     126 ..      14     152 ..       8     154 .. 0.87

  Alignments for each domain:
  == domain 1  score: 140.7 bits;  conditional E-value: 1.2e-45
       UPF0054   3 ieedleklikkvleeal...kkekle....evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeee............lGDivisvekakeq 80 
                   i+e++ k+i++ + ++l        +    e+sv++vdn+ i+elnk+yr +dk+TDVLSFp+ e ++ e             lGDivis+eka+eq
  VIMSS3531803  14 IDESISKIIEDSVLNTLkifM----DdenyEISVMIVDNQFIKELNKHYRSIDKETDVLSFPIFEFKNGELqediaiveeeipLGDIVISIEKAYEQ 106
                   455566666666666663321....23467***********************************999933568*********************** PP

       UPF0054  81 aeeyghslerelafllvHgllHllGYDHeeeeeekeMeekeeeile 126
                   a+e+ghs+ere+a+l+vH++lHllG+DH+eee++  M++ ee +le
  VIMSS3531803 107 AKEFGHSVEREIAYLTVHSVLHLLGFDHIEEEDRMLMRKYEEMVLE 152
                   ******************************************9997 PP



Or compare VIMSS3531803 to CDD or PaperBLAST