VIMSS3531803 has 158 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-46 144.2 3.9 1.2e-46 144.0 3.9 1.0 1 VIMSS3531803 Domain annotation for each sequence (and alignments): >> VIMSS3531803 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 144.0 3.9 1.2e-46 1.2e-46 4 127 .. 15 152 .. 9 154 .. 0.94 Alignments for each domain: == domain 1 score: 144.0 bits; conditional E-value: 1.2e-46 YbeY 4 eeeleklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee..............lGDivisvekaeeqaeeyg 86 +e+++k+i++ + ++lk + ++++e+sv++vdn+ ikelnk+yr++dk+TDVLSFp+ e ++ lGDivis+eka eqa+e+g VIMSS3531803 15 DESISKIIEDSVLNTLKIFMDDENYEISVMIVDNQFIKELNKHYRSIDKETDVLSFPIFEFKNGelqediaiveeeipLGDIVISIEKAYEQAKEFG 111 566777888888888888888999*************************************9999******************************** PP YbeY 87 hslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilk 127 hs+ere+a+l+vH++LHLlG+DH+eee++ M++ ee +l+ VIMSS3531803 112 HSVEREIAYLTVHSVLHLLGFDHIEEEDRMLMRKYEEMVLE 152 *************************************9997 PP
Or compare VIMSS3531803 to CDD or PaperBLAST