PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS46061 to PF02130 (UPF0054)

VIMSS46061 has 135 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-38  117.8   1.0    1.7e-38  117.5   1.0    1.0  1  VIMSS46061  


Domain annotation for each sequence (and alignments):
>> VIMSS46061  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  117.5   1.0   1.7e-38   1.7e-38      22     127 ..      18     121 ..       4     122 .. 0.91

  Alignments for each domain:
  == domain 1  score: 117.5 bits;  conditional E-value: 1.7e-38
     UPF0054  22 ekleevsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeeelGDivisvekakeqaeeyghslerelafllvHgllHllGYDHeeeeeekeMeek 120
                 ++ ++v++++vd +e++e+n e+r++dk+TDVLSFple+ +e+  lG +vi v+ ake+a+e ghs+e+e+++l++H++lHllG+DHe  +++ eM+ek
  VIMSS46061  18 LSPKDVELVFVDSKEMQEINLEQRKQDKTTDVLSFPLENIDESLPLGSVVINVDLAKEKAKELGHSYEEEISLLFIHAMLHLLGFDHE--NDNGEMREK 114
                 33449**********************************999988******************************************8..88999**** PP

     UPF0054 121 eeeilee 127
                 e+e++e+
  VIMSS46061 115 EKELIEH 121
                 ***9987 PP



Or compare VIMSS46061 to CDD or PaperBLAST