VIMSS521403 has 196 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-39 120.9 0.0 2.1e-39 120.6 0.0 1.1 1 VIMSS521403 Domain annotation for each sequence (and alignments): >> VIMSS521403 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 120.6 0.0 2.1e-39 2.1e-39 11 127 .. 19 148 .. 11 150 .. 0.95 Alignments for each domain: == domain 1 score: 120.6 bits; conditional E-value: 2.1e-39 YbeY 11 ikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee.............lGDivisvekaeeqaeeyghslerelaf 95 + +v++ +l e++++ +ae ++ +vd +++++l+ ++++ + pTDV+SFp++e + lGDi++++e a++qa+++gh++ +ela+ VIMSS521403 19 LIDVATFVLGEMDVHPDAEATISVVDVATMSDLHVRWMDLEGPTDVMSFPMDELTPGmgrpdaqpfgpamLGDIILCPEFAAKQAAKAGHDMGHELAL 116 445668889999******************************************9999**************************************** PP YbeY 96 llvHglLHLlGYDHeeeeeekeMeekeeeilk 127 l++Hg+LHLlGYDH+e+e+e+eM+++++e+l+ VIMSS521403 117 LTTHGCLHLLGYDHIEPEDEQEMFALQNELLQ 148 *****************************997 PP
Or compare VIMSS521403 to CDD or PaperBLAST