PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS521403 to PF02130 (UPF0054)

VIMSS521403 has 196 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.4e-39  119.2   0.0    6.7e-39  118.9   0.0    1.1  1  VIMSS521403  


Domain annotation for each sequence (and alignments):
>> VIMSS521403  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  118.9   0.0   6.7e-39   6.7e-39      12     126 ..      21     148 ..      11     150 .. 0.90

  Alignments for each domain:
  == domain 1  score: 118.9 bits;  conditional E-value: 6.7e-39
      UPF0054  12 kkvleealkkekle...evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeee.ee..........lGDivisvekakeqaeeyghslerelafl 95 
                  + v+  +l +++++   e ++ +vd +++ +l+ ++++ + pTDV+SFp++e      +          lGDi++++e a++qa ++gh + +ela+l
  VIMSS521403  21 D-VATFVLGEMDVHpdaEATISVVDVATMSDLHVRWMDLEGPTDVMSFPMDELTPGmGRpdaqpfgpamLGDIILCPEFAAKQAAKAGHDMGHELALL 117
                  3.346777777787889***********************************99985226899*********************************** PP

      UPF0054  96 lvHgllHllGYDHeeeeeekeMeekeeeile 126
                  ++Hg+lHllGYDH+e+e+e+eM+++++e+l+
  VIMSS521403 118 TTHGCLHLLGYDHIEPEDEQEMFALQNELLQ 148
                  *****************************98 PP



Or compare VIMSS521403 to CDD or PaperBLAST