VIMSS561885 has 151 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-29 86.9 0.0 6.3e-29 86.7 0.0 1.0 1 VIMSS561885 Domain annotation for each sequence (and alignments): >> VIMSS561885 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.7 0.0 6.3e-29 6.3e-29 11 126 .. 21 135 .. 13 138 .. 0.90 Alignments for each domain: == domain 1 score: 86.7 bits; conditional E-value: 6.3e-29 YbeY 11 ikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeeelGDivisvekaeeqaeeyghslerelafllvHglLHLlGYD 108 + k++ +++++ k e+s l++d+e+i + n+e+ ++d+ TD+++F e+++ GD++is+++++++a+ + ++e+el+ +++Hg+LHL+G VIMSS561885 21 VGKWIAEVCSR-YGKAVGEISYLFCDDEYILKANQEFLDHDYYTDIITFDSCEADTVNGDLLISLDTVRSNARALDLRYEDELHRVIIHGILHLCGLK 117 55666666652.2344559******************************************************************************* PP YbeY 109 HeeeeeekeMeekeeeil 126 ++++++e++M++ ee+ l VIMSS561885 118 DKSKKDEAQMRAAEEKAL 135 **************9987 PP
Or compare VIMSS561885 to CDD or PaperBLAST