PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS956846 to PF02130 (UPF0054)

VIMSS956846 has 176 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      5e-42  129.0   0.2      6e-42  128.7   0.2    1.1  1  VIMSS956846  


Domain annotation for each sequence (and alignments):
>> VIMSS956846  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  128.7   0.2     6e-42     6e-42       5     128 .]      16     158 ..      13     158 .. 0.89

  Alignments for each domain:
  == domain 1  score: 128.7 bits;  conditional E-value: 6e-42
      UPF0054   5 edleklikkvleeal........kkekle.....evsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeee..........lGDivisvekake 79 
                  +++e+l+++++++a+                   e+sv++ dn++++ lnk++r+kd+pT+VLSFp+ e ee  e          lGDi++++++ak+
  VIMSS956846  16 SNWEALAQTACQQAVsvsasdflL----AkdyetEISVCFSDNDTVHALNKTWRDKDRPTNVLSFPMMEAEELAEiknrvgseclLGDIILAFDVAKK 109
                  677888888888888666655441....134558***********************************9999335789******************* PP

      UPF0054  80 qaeeyghslerelafllvHgllHllGYDHeeeeeekeMeekeeeileel 128
                  +a e+g sle+++++l++Hg+lHllGYDH+ ++e+++Me++e++ l++l
  VIMSS956846 110 EALEKGISLENHVTHLITHGTLHLLGYDHILDNEAEIMEDLERKALAQL 158
                  ********************************************99875 PP



Or compare VIMSS956846 to CDD or PaperBLAST