PaperBLAST – Find papers about a protein or its homologs

 

Align WP_002866735.1 to PF02130 (UPF0054)

WP_002866735.1 has 134 amino acids

Query:       UPF0054  [M=128]
Accession:   PF02130.17
Description: Uncharacterized protein family UPF0054
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.4e-38  117.8   1.0    1.7e-38  117.6   1.0    1.0  1  WP_002866735.1  


Domain annotation for each sequence (and alignments):
>> WP_002866735.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  117.6   1.0   1.7e-38   1.7e-38      22     127 ..      18     121 ..       4     122 .. 0.91

  Alignments for each domain:
  == domain 1  score: 117.6 bits;  conditional E-value: 1.7e-38
         UPF0054  22 ekleevsvllvdneeirelnkeyrgkdkpTDVLSFpleeeeeeeelGDivisvekakeqaeeyghslerelafllvHgllHllGYDHeeeeeeke 116
                     ++ ++v++++vd +e++e+n e+r++dk+TDVLSFple+ +e+  lG +vi v+ ake+a+e ghs+e+e+++l++H++lHllG+DHe  +++ e
  WP_002866735.1  18 LSPKDVELVFVDSKEMQEINLEQRKQDKTTDVLSFPLENIDESLPLGSVVINVDLAKEKAKELGHSYEEEISLLFIHAMLHLLGFDHE--NDNGE 110
                     33449**********************************999988******************************************8..88999 PP

         UPF0054 117 Meekeeeilee 127
                     M+eke+e++e+
  WP_002866735.1 111 MREKEKELIEH 121
                     *******9987 PP



Or compare WP_002866735.1 to CDD or PaperBLAST