WP_005060346.1 has 170 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-42 129.1 0.0 6e-42 128.8 0.0 1.1 1 WP_005060346.1 Domain annotation for each sequence (and alignments): >> WP_005060346.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 128.8 0.0 6e-42 6e-42 13 127 .. 20 146 .. 11 148 .. 0.95 Alignments for each domain: == domain 1 score: 128.8 bits; conditional E-value: 6e-42 YbeY 13 kvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee............lGDivisvekaeeqaeeyghslerelaf 95 +v++ a+++++++ aels++lvd +++++l+ ++++ pTDV+SFp++e e lGDiv++++ a+eqae +ghsl++ela+ WP_005060346.1 20 SVARFAIAAMDVHPAAELSMMLVDLAAMADLHMRWMDLPGPTDVMSFPMDELEPGgrpdapepgpsmLGDIVLCPQFAAEQAEAAGHSLAHELAL 114 45677888899*****************************************999**************************************** PP YbeY 96 llvHglLHLlGYDHeeeeeekeMeekeeeilk 127 l+vHg+LHLlGYDH e+eee+eM+++++++l+ WP_005060346.1 115 LTVHGVLHLLGYDHAEPEEEREMFALQNQLLQ 146 *****************************997 PP
Or compare WP_005060346.1 to CDD or PaperBLAST