WP_008571323.1 has 161 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-38 117.8 0.0 1.9e-38 117.5 0.0 1.0 1 WP_008571323.1 Domain annotation for each sequence (and alignments): >> WP_008571323.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 117.5 0.0 1.9e-38 1.9e-38 11 128 .. 27 150 .. 22 151 .. 0.93 Alignments for each domain: == domain 1 score: 117.5 bits; conditional E-value: 1.9e-38 YbeY 11 ikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee........lGDivisvekaeeqaeeyghslerelafll 97 ++k++ aalk +ea l v +vd++e +ln++yr+kd++T+VLSFp+e +e lGD+vi++ +++++a+e+g+ l+ ++a+l+ WP_008571323.1 27 FRKWVAAALK--GRIREADLAVRVVDEKEGCSLNHHYRGKDYATNVLSFPAELPEGLpkgikmplLGDLVICAPVVAREAAEQGKLLAAHYAHLT 119 5677777776..556789*********************************99988899************************************ PP YbeY 98 vHglLHLlGYDHeeeeeekeMeekeeeilkk 128 vHg+LHLlG+DHe+++e++ Me++e+eil++ WP_008571323.1 120 VHGTLHLLGWDHEDDKEAEAMEQLEREILAD 150 ****************************986 PP
Or compare WP_008571323.1 to CDD or PaperBLAST