WP_011241793.1 has 165 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-38 115.8 0.0 7.6e-38 115.5 0.0 1.0 1 WP_011241793.1 Domain annotation for each sequence (and alignments): >> WP_011241793.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.5 0.0 7.6e-38 7.6e-38 11 128 .. 19 155 .. 14 156 .. 0.95 Alignments for each domain: == domain 1 score: 115.5 bits; conditional E-value: 7.6e-38 YbeY 11 ikkvleaalkeeklkke.aelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee..................lGDivisvekaeeqaeeyg 86 ++++++a+l+++ l+ e +e+s+l +d+++i++ln+e+r+k +pT+VLS+p+e+ e lGDi i++++++++a+ +g WP_011241793.1 19 ADRAISATLAQMGLDPElCEISLLGCDDARITALNAEFREKPSPTNVLSWPAEDLAAEtpggtplapepdftgavpLGDIAIAFDTCQREADAAG 113 5678888998899976636***********************************99999************************************ PP YbeY 87 hslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilkk 128 + +++++++l+vHglLHLlGYDH+++e+++ Me +e++il + WP_011241793.1 114 KPIADHVTHLIVHGLLHLLGYDHIRDEDATLMEGLETRILGN 155 ***************************************976 PP
Or compare WP_011241793.1 to CDD or PaperBLAST