WP_012000180.1 has 165 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-44 137.1 1.1 1.9e-44 136.9 1.1 1.0 1 WP_012000180.1 Domain annotation for each sequence (and alignments): >> WP_012000180.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 136.9 1.1 1.9e-44 1.9e-44 5 128 .. 14 159 .. 11 160 .. 0.94 Alignments for each domain: == domain 1 score: 136.9 bits; conditional E-value: 1.9e-44 YbeY 5 eeleklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeee.......................lGDivisve 76 ee+ k+++++le a++ ++ k++ e+ v++v+ne+ +eln eyr++d+pTDV+S +++ e + +G+++isv+ WP_012000180.1 14 EEIIKQTQDILEFAAQ-KTGKEKKEMAVTFVTNERSHELNLEYRDTDRPTDVISLEYKPELDIavdeedllnhpelaemlddfdayIGELFISVD 107 5667788888888887.5668889********************************999988899****************************** PP YbeY 77 kaeeqaeeyghslerelafllvHglLHLlGYDHeeeeeekeMeekeeeilkk 128 ka+eqaeeyghs++re++fl+vHg+LH+ GYDH ++eee+eM+ ++eeil++ WP_012000180.1 108 KAREQAEEYGHSFKREMGFLAVHGFLHINGYDHYTPEEEAEMFGLQEEILTA 159 *************************************************986 PP
Or compare WP_012000180.1 to CDD or PaperBLAST