XP_016883883.2 has 125 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-19 54.2 0.4 1.8e-13 36.7 0.0 2.1 2 XP_016883883.2 Domain annotation for each sequence (and alignments): >> XP_016883883.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.7 0.0 1.8e-13 1.8e-13 26 63 .. 33 70 .. 16 73 .. 0.86 2 ! 16.5 0.2 3.2e-07 3.2e-07 96 119 .. 72 95 .. 69 98 .. 0.87 Alignments for each domain: == domain 1 score: 36.7 bits; conditional E-value: 1.8e-13 YbeY 26 keaelsvllvdneeikelnkeyrnkdkpTDVLSFplee 63 +++ l ++ vdn++i+++n+ yr+++ pTDVLSFp++e XP_016883883.2 33 QKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHE 70 567899*****************************987 PP == domain 2 score: 16.5 bits; conditional E-value: 3.2e-07 YbeY 96 llvHglLHLlGYDHeeeeeekeMe 119 ++Hgl HLlG+ H +e+e +++ XP_016883883.2 72 TATHGLCHLLGFTHGTEAEWQQLC 95 579****************99875 PP
Or compare XP_016883883.2 to CDD or PaperBLAST