biolip::7y7oA has 147 amino acids
Query: YbeY [M=129] Accession: PF02130.21 Description: Endoribonuclease YbeY Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-50 155.9 0.5 3.1e-50 155.6 0.5 1.0 1 biolip::7y7oA Domain annotation for each sequence (and alignments): >> biolip::7y7oA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 155.6 0.5 3.1e-50 3.1e-50 5 128 .. 15 135 .. 12 136 .. 0.95 Alignments for each domain: == domain 1 score: 155.6 bits; conditional E-value: 3.1e-50 YbeY 5 eeleklikkvleaalkeeklkkeaelsvllvdneeikelnkeyrnkdkpTDVLSFpleeeeeelGDivisvekaeeqaeeyghslerelafllvHg 100 + + k+i+++le a kee+++++aelsv++vd++ei+e+n++yr+kdk+TDV+SF+l + lGDi+i++++a+eqa++yghs+erel+fl+ Hg biolip::7y7oA 15 DAWYKQIEDLLEFAKKEEHIEDDAELSVTFVDKQEIQEINRTYRDKDKVTDVISFALP---RVLGDIIICTDVAQEQANNYGHSFERELGFLALHG 107 567789999**********************************************885...469******************************** PP YbeY 101 lLHLlGYDHeeeeeekeMeekeeeilkk 128 +LHLlGYDH++e++ekeM+ ++++il++ biolip::7y7oA 108 FLHLLGYDHMTEADEKEMFGRQDTILNA 135 **************************86 PP
Or compare biolip::7y7oA to CDD or PaperBLAST