PaperBLAST – Find papers about a protein or its homologs

 

Align CharProtDB::CH_123932 to PF02582 (DUF155)

CharProtDB::CH_123932 has 390 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    1.7e-44  138.1   0.3      3e-44  137.4   0.3    1.4  1  CharProtDB::CH_123932  


Domain annotation for each sequence (and alignments):
>> CharProtDB::CH_123932  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.4   0.3     3e-44     3e-44       2     176 .]     146     328 ..     145     328 .. 0.93

  Alignments for each domain:
  == domain 1  score: 137.4 bits;  conditional E-value: 3e-44
                 DUF155   2 fiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeq........sessrikgdvivlksk....sllekla 77 
                            +i +nG+ V w+l+eee  +fl  l+  + e    ++ +  e+ee+++++ +q        + +s+++g+++v++      +ll++ a
  CharProtDB::CH_123932 146 MILSNGTLVGWNLTEEEIVQFLPILEDDCIE----NKFDAFESEEIDWIELKQqlpqdplnQGTSYLHGEIMVIQGPtmekRLLDMAA 229
                            799******************9977777666....57888889******999999999998666779999999977779999****** PP

                 DUF155  78 iShalaqSvkLdvlEesldellestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavsey 165
                            ++ +l++S++L++lE++l+++l  t+k ++ la++++++ +++e lk tg+l+ lr +lnl+sel+dtPd++W+ep+le++y ++s+ 
  CharProtDB::CH_123932 230 FAVGLSRSTRLSILETQLEDYLHLTKKNSEILANGKQITTTEHEFLKITGQLFLLRGKLNLYSELIDTPDLYWSEPTLEKIYYSISKI 317
                            *********************************99999999*********************************************** PP

                 DUF155 166 leikeRikiLn 176
                            l+i++Ri iLn
  CharProtDB::CH_123932 318 LDINSRISILN 328
                            **********9 PP



Or compare CharProtDB::CH_123932 to CDD or PaperBLAST