PaperBLAST – Find papers about a protein or its homologs

 

Align NP_196865.1 to PF02582 (DUF155)

NP_196865.1 has 402 amino acids

Query:       DUF155  [M=176]
Accession:   PF02582.14
Description: Uncharacterised ACR, YagE family COG1723
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-30   92.8   0.0    2.6e-30   92.0   0.0    1.4  1  NP_196865.1  


Domain annotation for each sequence (and alignments):
>> NP_196865.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.0   0.0   2.6e-30   2.6e-30       1     175 [.     182     352 ..     182     353 .. 0.90

  Alignments for each domain:
  == domain 1  score: 92.0 bits;  conditional E-value: 2.6e-30
       DUF155   1 vfiFknGsvVfwgldeeeeknflnkllkflneeselpreeeqeteeleyvydeq.sessrikgdvivlkskslleklaiShalaqSvkLdvlEeslde 97 
                  +++F++Gs+V++++ e+e++++l+ ++++++         e+ ++e+e +++++ ++  ++  d i l+  ++    +i  +l qS++Ld++ +++d 
  NP_196865.1 182 MVVFHYGSIVLFNVREHEVDEYLKVVERHASGL-----LPEMRKDEYEVRENPNlDTWMEVGRDFIRLQFLNTDGIRTIGCVLGQSIALDYYGRQVDG 274
                  58**********************999886654.....2333356666666665555567999*****9999************************** PP

       DUF155  98 llestekipkelakkgklklsrkellkktgellslrinlnlkselldtPdffWeepeleslyeavseyleikeRikiL 175
                  +++++++i+++l+ +g+ +++rk+l++++g+ + + ++++lk  l+++ d+ W+++++ +++e +++++e+++ + +L
  NP_196865.1 275 MVAEFTEINRQLEITGTFTMKRKKLFQLVGKANVILADVILKLGLFERSDIAWKDAKYGQIWEFLRDEFELTQSFANL 352
                  ****************88*****************************************************9988776 PP



Or compare NP_196865.1 to CDD or PaperBLAST